DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31086 and CG44250

DIOPT Version :9

Sequence 1:NP_001247312.1 Gene:CG31086 / 43179 FlyBaseID:FBgn0051086 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001163133.1 Gene:CG44250 / 19836034 FlyBaseID:FBgn0265185 Length:297 Species:Drosophila melanogaster


Alignment Length:142 Identity:76/142 - (53%)
Similarity:101/142 - (71%) Gaps:1/142 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 HSWLHFS-NGAIPQAAVVAGHDSDGDTIFIGRAFYCNDMLPAKIIPNKGKAYVAYANQEVELENY 67
            ::|:|.| ...:|..||:.|||||...|::||:|:..:.||||::|:||.|||||...|....:|
  Fly    14 NTWVHSSPYSPLPPYAVIGGHDSDRTPIYVGRSFHEGENLPAKVVPSKGCAYVAYGGAEHTKTHY 78

  Fly    68 EVLSGFNYEWLPAENGEVPPGAVKVGQNVDGETLYAGRGYHAGSLTVGKVHPSHGCLYIPYDSEE 132
            |||.|..:.|:|:.:|.|||.||:.|....||.||.|||:||||||||||||||||||||:..:|
  Fly    79 EVLVGQGFAWVPSSSGGVPPNAVRSGTTRTGEPLYVGRGHHAGSLTVGKVHPSHGCLYIPFGGQE 143

  Fly   133 VKIFAYEVLSRR 144
            |:|..||||.::
  Fly   144 VRINTYEVLIKQ 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31086NP_001247312.1 DM9 3..73 CDD:128937 32/69 (46%)
DUF3421 24..134 CDD:288732 62/109 (57%)
DM9 74..143 CDD:128937 43/68 (63%)
CG44250NP_001163133.1 DM9 13..84 CDD:128937 32/69 (46%)
DUF3421 35..145 CDD:288732 62/109 (57%)
DM9 85..155 CDD:128937 43/69 (62%)
DM9 157..227 CDD:128937
DUF3421 178..287 CDD:288732
DM9 228..297 CDD:128937
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449317
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1154851at2759
OrthoFinder 1 1.000 - - FOG0005929
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31649
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.