DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6142 and CG45065

DIOPT Version :9

Sequence 1:NP_651466.1 Gene:CG6142 / 43178 FlyBaseID:FBgn0039415 Length:616 Species:Drosophila melanogaster
Sequence 2:NP_001285251.1 Gene:CG45065 / 19835504 FlyBaseID:FBgn0266435 Length:613 Species:Drosophila melanogaster


Alignment Length:575 Identity:262/575 - (45%)
Similarity:374/575 - (65%) Gaps:5/575 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 NRIPDTTRFLPEYDFIIVGAGSAGCVMANRLSEISSASVLLLEAGDQETFISDVPLTAALTQMTR 100
            |::.:.|....:|||:::|.||||.|:||||||:.:.:|||||||..||.|||||..|...|:|.
  Fly    32 NKVQEPTVIRRQYDFVVIGGGSAGAVVANRLSEVRNWTVLLLEAGGDETEISDVPALAGYLQLTE 96

  Fly   101 YNWGYKAEP--TEHACQGLKGGVCNWPKGRGVGGTSLINFMLYTRGHRRDYDEWAAANNSGWSYD 163
            .:|.|:..|  |...||.:||..|.||:|:.:||:|::|.|:|.||.:.||:.||:..|.||.||
  Fly    97 LDWKYQTTPSSTRQYCQAMKGDRCFWPRGKVLGGSSVLNAMVYVRGSKNDYNHWASLGNPGWDYD 161

  Fly   164 ELLPYFRKSERIGIPELYKSPYHGRNGQLDVQYTDYRSQLLKAFLKSGREMGYEITDPNGEHLMG 228
            .:|.||.|||.:..|.|.|:|||...|.|.||...:|:.|..|||::|.|||||..|.||....|
  Fly   162 SMLKYFLKSEDVRNPYLAKTPYHETGGYLTVQEAPWRTPLSIAFLQAGIEMGYENRDINGAQQTG 226

  Fly   229 FARSQATIRNGRRCSTSKAFIQPVVNRKNLHISMKSWVTRLIIDPITKTATGVEFVKQRQRYVVR 293
            |..:|:|||.|.||||.||||:||..|||..:.:.:..||::.|. .|.|.|||:::..::.||.
  Fly   227 FMLTQSTIRRGARCSTGKAFIRPVRQRKNFDVLLHAEATRILFDK-QKRAIGVEYMRGGRKNVVF 290

  Fly   294 ARKEVILSAGTIASPQLLMLSGIGPAEHLREHNITVMQDLPVGYNLQDHITLNGLVFVVN-DSTV 357
            .|:|||.|||.:.:|:||||||:||||||:||||.|:.|||||.|:|||:.|.||.|||: ..||
  Fly   291 VRREVIASAGALNTPKLLMLSGVGPAEHLQEHNIPVISDLPVGNNMQDHVGLGGLTFVVDAPLTV 355

  Fly   358 NDARLLNPSDIFRYIFAGQGPYTIPGGAEAFAFVRTPSSKFAKDYPDMELVLGAGSLSGDRFGTM 422
            ...|.........||...:||.|. .|.|..||:.|.....:.|:||::......|::.|....:
  Fly   356 TRNRFQTIPVSMEYILRERGPMTF-SGVEGVAFLNTKYQDPSVDWPDVQFHFCPSSINSDGGEQI 419

  Fly   423 RNLLGITDEFYDYMFGDLQSKETFGLVPVLLRPKSRGRISLRSRNPFHWPRMEPNFMQHPDDVRA 487
            |.:|.:.|.||:.::..||..||:.::|:||||||.|.:.|.||||.|.|::.||:..|.:|:..
  Fly   420 RKILNLRDGFYNTVYKPLQHSETWSILPLLLRPKSTGWVRLNSRNPQHQPKIIPNYFAHQEDIDV 484

  Fly   488 MIEGIEMILKLSRSKPMAKMGTRFHDRPFPGCENLKFASEAYWKCCLRRYGSSLQHQSGTCKMGP 552
            ::|||::.:.:|.::...:.|:|.|:.|.|||.:|.|.|..||.||::.:..::.|.:|||:|||
  Fly   485 LVEGIKLAINVSNTQAFQRFGSRLHNIPLPGCRHLPFQSNEYWACCIKEFTFTIYHPAGTCRMGP 549

  Fly   553 ATDNTSVVDAQLRIHGIRGLRVVDASVLPNVPAGHTNAIVIMVAEKAGDMIKDAW 607
            :.|.|:|||.:||::|:.|:||||||::|.:..|:.||.||.:.|||.|:||:.|
  Fly   550 SWDVTAVVDPRLRVYGVSGVRVVDASIMPTIVNGNPNAPVIAIGEKASDLIKEDW 604

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6142NP_651466.1 PRK02106 47..604 CDD:235000 257/559 (46%)
NADB_Rossmann 48..342 CDD:304358 153/295 (52%)
GMC_oxred_C 455..599 CDD:282984 62/143 (43%)
CG45065NP_001285251.1 PRK02106 42..601 CDD:235000 257/560 (46%)
NADB_Rossmann 117..339 CDD:304358 114/222 (51%)
GMC_oxred_C 452..596 CDD:282984 62/143 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 103 1.000 Domainoid score I2249
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 163 1.000 Inparanoid score I1608
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000165
OrthoInspector 1 1.000 - - otm24368
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11552
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X135
77.060

Return to query results.
Submit another query.