DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14551 and CFAP97D1

DIOPT Version :10

Sequence 1:NP_651462.1 Gene:CG14551 / 43171 FlyBaseID:FBgn0039408 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001129955.1 Gene:CFAP97D1 / 284067 HGNCID:37241 Length:164 Species:Homo sapiens


Alignment Length:78 Identity:27/78 - (34%)
Similarity:41/78 - (52%) Gaps:0/78 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 YAQHREKVMSARPAIDTHSPRAHEHVQRKWKKQQVERERQQQIERENLRLLQKLGDIMRTKRINN 82
            |..|:.::..|:|.:||..|.||.:...|..|.|.|:::..:||.||.:|.||:.:..|.....:
Human    32 YVSHKNRIQIAKPTVDTKPPVAHTNHILKLSKLQGEQKKINKIEYENKQLCQKIANAHRGPAKVD 96

  Fly    83 LWLEPRPNFLNRE 95
            .|.|.....||||
Human    97 CWNEYFSKSLNRE 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14551NP_651462.1 Hmw_CFAP97 22..>101 CDD:464014 25/74 (34%)
CFAP97D1NP_001129955.1 Hmw_CFAP97 36..129 CDD:464014 25/74 (34%)

Return to query results.
Submit another query.