DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL34a and RPL34A

DIOPT Version :9

Sequence 1:NP_001189295.1 Gene:RpL34a / 43169 FlyBaseID:FBgn0039406 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_010977.2 Gene:RPL34A / 856784 SGDID:S000002135 Length:121 Species:Saccharomyces cerevisiae


Alignment Length:118 Identity:68/118 - (57%)
Similarity:82/118 - (69%) Gaps:1/118 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVQRLTLRRRLSYNTRSNKRRIVRTPGGRLVYQYVKKNPTVPRCGQCKEKLHGITPSRPSERPRM 65
            |.||:|.|||..|||||||.::|:||||.|..|:|||..|.|:||.|...|.||:..||.:...:
Yeast     1 MAQRVTFRRRNPYNTRSNKIKVVKTPGGILRAQHVKKLATRPKCGDCGSALQGISTLRPRQYATV 65

  Fly    66 SKRLKTVSRTYGGVLCHSCLRERIVRAFLIEEQKIV-KALKSQREALVKPVKK 117
            ||..|||||.|||..|.:|::|||:||||||||||| |.:|.|.||..|..||
Yeast    66 SKTHKTVSRAYGGSRCANCVKERIIRAFLIEEQKIVKKVVKEQTEAAKKSEKK 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL34aNP_001189295.1 Ribosomal_L34e 1..94 CDD:279532 51/92 (55%)
RPL34ANP_010977.2 Ribosomal_L34e 1..94 CDD:395956 51/92 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346183
Domainoid 1 1.000 109 1.000 Domainoid score I1400
eggNOG 1 0.900 - - E1_COG2174
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H105146
Inparanoid 1 1.050 129 1.000 Inparanoid score I1251
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53677
OrthoFinder 1 1.000 - - FOG0001807
OrthoInspector 1 1.000 - - mtm9178
orthoMCL 1 0.900 - - OOG6_100855
Panther 1 1.100 - - O PTHR10759
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1131
SonicParanoid 1 1.000 - - X1166
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.