DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL34a and AT3G28900

DIOPT Version :9

Sequence 1:NP_001189295.1 Gene:RpL34a / 43169 FlyBaseID:FBgn0039406 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_189532.1 Gene:AT3G28900 / 822524 AraportID:AT3G28900 Length:120 Species:Arabidopsis thaliana


Alignment Length:119 Identity:59/119 - (49%)
Similarity:79/119 - (66%) Gaps:2/119 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVQRLTLRRRLSYNTRSNKRRIVRTPGGRLVYQYVKKNPTVPRCGQCKEKLHGITPSRPSE--RP 63
            |||||..|.|.||.|:||:.|||:||||:|.||...|..:.|:|....:::.||...||:|  |.
plant     1 MVQRLVYRSRHSYATKSNQHRIVKTPGGKLTYQTTNKRASGPKCPVTGKRIQGIPHLRPAEYKRS 65

  Fly    64 RMSKRLKTVSRTYGGVLCHSCLRERIVRAFLIEEQKIVKALKSQREALVKPVKK 117
            |:::..:||:|.|||||....:|||||||||:|||||||.:...::|..|...|
plant    66 RLARNERTVNRAYGGVLSGVAVRERIVRAFLVEEQKIVKKVLKLQKAKEKTAPK 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL34aNP_001189295.1 Ribosomal_L34e 1..94 CDD:279532 47/94 (50%)
AT3G28900NP_189532.1 PLN03166 1..96 CDD:178710 47/94 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 102 1.000 Domainoid score I2286
eggNOG 1 0.900 - - E1_COG2174
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H105146
Inparanoid 1 1.050 119 1.000 Inparanoid score I1988
OMA 1 1.010 - - QHG53677
OrthoDB 1 1.010 - - D1517591at2759
OrthoFinder 1 1.000 - - FOG0001807
OrthoInspector 1 1.000 - - mtm1044
orthoMCL 1 0.900 - - OOG6_100855
Panther 1 1.100 - - LDO PTHR10759
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1166
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.840

Return to query results.
Submit another query.