DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL34a and AT3G28900

DIOPT Version :10

Sequence 1:NP_651460.2 Gene:RpL34a / 43169 FlyBaseID:FBgn0039406 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_189532.1 Gene:AT3G28900 / 822524 AraportID:AT3G28900 Length:120 Species:Arabidopsis thaliana


Alignment Length:122 Identity:27/122 - (22%)
Similarity:44/122 - (36%) Gaps:29/122 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   764 EAVLTTQQQQHQHQQQQQQQHQQPTESQSHSQRDGSSIVGGSFSPDVSASYRTASIDDRQQKTPI 828
            |..||||||:.    .::...::.....:...|.|..:......|....|::..:|.| |...|.
plant     4 EFSLTTQQQEF----LKEAYGKEIQAKVNWCSRYGKRLQVQQRKPKCKQSFKLPAIAD-QSILPS 63

  Fly   829 DSMSLAQDASDAHRMIKKQQQQQQHPLDVTPGTAIEVPVVTIMERATTSEAASQPPA 885
            ..:|              :::...|     ||.|.|..     |:.:|:.||...||
plant    64 AELS--------------KKEHFHH-----PGRAKEAD-----EKESTNMAAEMRPA 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL34aNP_651460.2 Ribosomal_L34e 1..94 CDD:426119
AT3G28900NP_189532.1 PLN03166 1..96 CDD:178710 25/120 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.