DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL34a and rpl34

DIOPT Version :9

Sequence 1:NP_001189295.1 Gene:RpL34a / 43169 FlyBaseID:FBgn0039406 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_957416.1 Gene:rpl34 / 394097 ZFINID:ZDB-GENE-040426-1033 Length:117 Species:Danio rerio


Alignment Length:112 Identity:67/112 - (59%)
Similarity:77/112 - (68%) Gaps:3/112 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVQRLTLRRRLSYNTRSNKRRIVRTPGGRLVYQYVKKNPTVPR--CGQCKEKLHGITPSRPSERP 63
            ||||||.||||||||.|||.|:.||||.|:||.|.||....|:  ||.|..:|.||...||....
Zfish     1 MVQRLTYRRRLSYNTASNKTRLSRTPGNRIVYLYTKKTGKSPKSACGICPGRLRGIRAVRPQVLM 65

  Fly    64 RMSKRLKTVSRTYGGVLCHSCLRERIVRAFLIEEQKI-VKALKSQRE 109
            |:||..|.|||.|||.:|..|:|:||.|||||||||| ||.||:|.:
Zfish    66 RLSKTKKHVSRAYGGSMCAKCVRDRIKRAFLIEEQKIVVKVLKAQAQ 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL34aNP_001189295.1 Ribosomal_L34e 1..94 CDD:279532 54/94 (57%)
rpl34NP_957416.1 Ribosomal_L34e 1..96 CDD:279532 54/94 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 108 1.000 Domainoid score I6376
eggNOG 1 0.900 - - E1_COG2174
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H105146
Inparanoid 1 1.050 124 1.000 Inparanoid score I4691
OMA 1 1.010 - - QHG53677
OrthoDB 1 1.010 - - D1517591at2759
OrthoFinder 1 1.000 - - FOG0001807
OrthoInspector 1 1.000 - - otm26621
orthoMCL 1 0.900 - - OOG6_100855
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1131
SonicParanoid 1 1.000 - - X1166
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.770

Return to query results.
Submit another query.