DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL34a and Rpl34

DIOPT Version :9

Sequence 1:NP_001189295.1 Gene:RpL34a / 43169 FlyBaseID:FBgn0039406 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_001102037.1 Gene:Rpl34 / 362041 RGDID:1309402 Length:117 Species:Rattus norvegicus


Alignment Length:113 Identity:66/113 - (58%)
Similarity:78/113 - (69%) Gaps:3/113 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVQRLTLRRRLSYNTRSNKRRIVRTPGGRLVYQYVKKNPTVPR--CGQCKEKLHGITPSRPSERP 63
            ||||||.||||||||.|||.|:.||||.|:||.|.||....|:  ||.|..:|.|:...||....
  Rat     1 MVQRLTYRRRLSYNTASNKTRLSRTPGNRIVYLYTKKVGKAPKSACGVCPGRLRGVRAVRPKVLM 65

  Fly    64 RMSKRLKTVSRTYGGVLCHSCLRERIVRAFLIEEQKI-VKALKSQREA 110
            |:||..|.|||.|||.:|..|:|:||.|||||||||| ||.||:|.::
  Rat    66 RLSKTKKHVSRAYGGSMCAKCVRDRIKRAFLIEEQKIVVKVLKAQAQS 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL34aNP_001189295.1 Ribosomal_L34e 1..94 CDD:279532 53/94 (56%)
Rpl34NP_001102037.1 Ribosomal_L34e 1..96 CDD:395956 53/94 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 108 1.000 Domainoid score I6293
eggNOG 1 0.900 - - E1_COG2174
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H105146
Inparanoid 1 1.050 124 1.000 Inparanoid score I4623
OMA 1 1.010 - - QHG53677
OrthoDB 1 1.010 - - D1517591at2759
OrthoFinder 1 1.000 - - FOG0001807
OrthoInspector 1 1.000 - - mtm8967
orthoMCL 1 0.900 - - OOG6_100855
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1166
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.740

Return to query results.
Submit another query.