DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL34a and rpl3402

DIOPT Version :9

Sequence 1:NP_001189295.1 Gene:RpL34a / 43169 FlyBaseID:FBgn0039406 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_588143.1 Gene:rpl3402 / 2538815 PomBaseID:SPCC1322.15 Length:111 Species:Schizosaccharomyces pombe


Alignment Length:102 Identity:58/102 - (56%)
Similarity:71/102 - (69%) Gaps:0/102 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVQRLTLRRRLSYNTRSNKRRIVRTPGGRLVYQYVKKNPTVPRCGQCKEKLHGITPSRPSERPRM 65
            |.||:|.||||:|||||||.||::|||..:.|.::||..|:||||.....|.||...||.|..|:
pombe     1 MAQRVTYRRRLAYNTRSNKTRIIKTPGNNIRYLHIKKLGTIPRCGDTGVPLQGIPALRPREFARL 65

  Fly    66 SKRLKTVSRTYGGVLCHSCLRERIVRAFLIEEQKIVK 102
            |...|.|.|.|||.|..:.:::|||||||||||||||
pombe    66 SHNQKKVQRAYGGCLSANAVKDRIVRAFLIEEQKIVK 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL34aNP_001189295.1 Ribosomal_L34e 1..94 CDD:279532 48/92 (52%)
rpl3402NP_588143.1 Ribosomal_L34e 1..94 CDD:279532 48/92 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 103 1.000 Domainoid score I1743
eggNOG 1 0.900 - - E1_COG2174
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H105146
Inparanoid 1 1.050 118 1.000 Inparanoid score I1518
OMA 1 1.010 - - QHG53677
OrthoFinder 1 1.000 - - FOG0001807
OrthoInspector 1 1.000 - - mtm9278
orthoMCL 1 0.900 - - OOG6_100855
Panther 1 1.100 - - O PTHR10759
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1131
SonicParanoid 1 1.000 - - X1166
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.