DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL34a and rpl-34

DIOPT Version :9

Sequence 1:NP_001189295.1 Gene:RpL34a / 43169 FlyBaseID:FBgn0039406 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_502330.1 Gene:rpl-34 / 178173 WormBaseID:WBGene00004448 Length:110 Species:Caenorhabditis elegans


Alignment Length:110 Identity:61/110 - (55%)
Similarity:80/110 - (72%) Gaps:1/110 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVQRLTLRRRLSYNTRSNKRRIVRTPGGRLVYQYVKKNPTVPRCGQCKEKLHGITPSRPSERPRM 65
            |..|:|.||||||||.|||:|:|:|||||||.||:||...:|:|.....|||||||:||.....:
 Worm     1 MSLRVTYRRRLSYNTTSNKKRLVKTPGGRLVVQYIKKRGQIPKCRDTGVKLHGITPARPIALRLL 65

  Fly    66 SKRLKTVSRTYGGVLCHSCLRERIVRAFLIEEQKIV-KALKSQRE 109
            .:..:||:|.|||.|..:.::|||.||||:|||||| |.:|.|::
 Worm    66 KRNERTVTRAYGGCLSPNAVKERITRAFLVEEQKIVNKVIKHQKD 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL34aNP_001189295.1 Ribosomal_L34e 1..94 CDD:279532 50/92 (54%)
rpl-34NP_502330.1 Ribosomal_L34e 1..94 CDD:307381 50/92 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166537
Domainoid 1 1.000 109 1.000 Domainoid score I3985
eggNOG 1 0.900 - - E1_COG2174
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H105146
Inparanoid 1 1.050 124 1.000 Inparanoid score I3285
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53677
OrthoDB 1 1.010 - - D1517591at2759
OrthoFinder 1 1.000 - - FOG0001807
OrthoInspector 1 1.000 - - otm14237
orthoMCL 1 0.900 - - OOG6_100855
Panther 1 1.100 - - LDO PTHR10759
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1131
SonicParanoid 1 1.000 - - X1166
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1514.840

Return to query results.
Submit another query.