DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL34a and rpl34

DIOPT Version :9

Sequence 1:NP_001189295.1 Gene:RpL34a / 43169 FlyBaseID:FBgn0039406 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_001352048.1 Gene:rpl34 / 101733401 XenbaseID:XB-GENE-957318 Length:117 Species:Xenopus tropicalis


Alignment Length:113 Identity:67/113 - (59%)
Similarity:78/113 - (69%) Gaps:3/113 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVQRLTLRRRLSYNTRSNKRRIVRTPGGRLVYQYVKKNPTVPR--CGQCKEKLHGITPSRPSERP 63
            ||||||.||||||||.|||.|:.||||.|:||.|.||....|:  ||.|..:|.||...||....
 Frog     1 MVQRLTYRRRLSYNTASNKTRLSRTPGNRIVYLYTKKVGKAPKSACGICPGRLRGIRAVRPKVLM 65

  Fly    64 RMSKRLKTVSRTYGGVLCHSCLRERIVRAFLIEEQKI-VKALKSQREA 110
            |:||..|.|||.|||.:|..|:|:||.|||||||||| ||.||:|.::
 Frog    66 RLSKTKKHVSRAYGGSMCAKCVRDRIKRAFLIEEQKIVVKVLKAQAQS 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL34aNP_001189295.1 Ribosomal_L34e 1..94 CDD:279532 54/94 (57%)
rpl34NP_001352048.1 Ribosomal_L34e 1..96 CDD:395956 54/94 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 108 1.000 Domainoid score I6339
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H105146
Inparanoid 1 1.050 124 1.000 Inparanoid score I4565
OMA 1 1.010 - - QHG53677
OrthoDB 1 1.010 - - D1517591at2759
OrthoFinder 1 1.000 - - FOG0001807
OrthoInspector 1 1.000 - - mtm9393
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1166
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.980

Return to query results.
Submit another query.