DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dak1 and ADK2

DIOPT Version :9

Sequence 1:NP_651456.1 Gene:Dak1 / 43165 FlyBaseID:FBgn0028833 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_011097.3 Gene:ADK2 / 856917 SGDID:S000000972 Length:225 Species:Saccharomyces cerevisiae


Alignment Length:215 Identity:55/215 - (25%)
Similarity:92/215 - (42%) Gaps:46/215 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 KPKIVFVLGGPGAGKGTQCSRIVDRF-QFTHLSAGDLLREERSREGSEFGNLIEDYIRNGKIVPV 125
            ||..:.:||.||:|||||.||::.:. |.:.:|:||:||:|...| |..|.....||..||::|.
Yeast    13 KPLRLLLLGAPGSGKGTQTSRLLKQIPQLSSISSGDILRQEIKSE-STLGREATTYIAQGKLLPD 76

  Fly   126 EVTCSLLENAMKASG----KSRFLIDGFPRNQDNLDGWNRQMSE-KVDFQFVLFFDCGEDVCVKR 185
            ::...|:...:.|.|    .:.:|:|||||........:..:.: ......|:..|..|...::|
Yeast    77 DLITRLITFRLSALGWLKPSAMWLLDGFPRTTAQASALDELLKQHDASLNLVVELDVPESTILER 141

  Fly   186 CLGR--------------------------GQSGSGRTDDNLDSLKKRISTYNNDSLPIIKFFEG 224
            ...|                          |:..:.|.||..:..|||:..|...:.|:..:::.
Yeast   142 IENRYVHVPSGRVYNLQYNPPKVPGLDDITGEPLTKRLDDTAEVFKKRLEEYKKTNEPLKDYYKK 206

  Fly   225 AGQVKRIDASPDAEEVFGEV 244
            :|             :||.|
Yeast   207 SG-------------IFGTV 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dak1NP_651456.1 UMP_CMP_kin_fam 65..249 CDD:273576 53/212 (25%)
ADK 65..240 CDD:238713 50/206 (24%)
ADK2NP_011097.3 adk 21..216 CDD:234711 52/207 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.