DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dak1 and AT4G25280

DIOPT Version :9

Sequence 1:NP_651456.1 Gene:Dak1 / 43165 FlyBaseID:FBgn0028833 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001320061.1 Gene:AT4G25280 / 828631 AraportID:AT4G25280 Length:259 Species:Arabidopsis thaliana


Alignment Length:248 Identity:96/248 - (38%)
Similarity:145/248 - (58%) Gaps:16/248 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MWRALARTTLRAVANDCGSPGVGLAPSALTQHQLRHSKASNRFITTTSTAPPHNIGIMSVEKPKI 65
            |||.:|..: ..:::...|..:..|.|.|   ::..|.|::........:||..      :.|.|
plant     1 MWRRVALLS-PMISSSSRSLKLSQAASGL---KVGESFATDIISQEERVSPPKE------KAPFI 55

  Fly    66 VFVLGGPGAGKGTQCSRIVDRFQFTHLSAGDLLREERSREGSEFGNLIEDYIRNGKIVPVEVTCS 130
            .|||||||:||||||.:||:.|...|||||||||.|.:.. :|.|.:|.:.|::|||||.|||..
plant    56 TFVLGGPGSGKGTQCEKIVETFGLQHLSAGDLLRREIAMH-TENGAMILNLIKDGKIVPSEVTVK 119

  Fly   131 LLENAMKASGKSRFLIDGFPRNQDNLDGWNRQMSEKVDFQFVLFFDCGEDVCVKRCLGRGQSGSG 195
            |::..:::|...:||||||||.::|...:.|.:  :.|...||||||.|:..|||.|.|.|   |
plant   120 LIQKELESSDNRKFLIDGFPRTEENRVAFERII--RADPDVVLFFDCPEEEMVKRVLNRNQ---G 179

  Fly   196 RTDDNLDSLKKRISTYNNDSLPIIKFFEGAGQVKRIDASPDAEEVFGEVEKIF 248
            |.|||:.::|||:..:|..:.|:|.:::..|::..|:|....:::|..|..||
plant   180 RIDDNITTMKKRLKIFNALNRPVIDYYKNKGKLYTINAVGTVDDIFQHVLPIF 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dak1NP_651456.1 UMP_CMP_kin_fam 65..249 CDD:273576 83/184 (45%)
ADK 65..240 CDD:238713 79/174 (45%)
AT4G25280NP_001320061.1 PLN02200 11..244 CDD:215125 92/237 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 158 1.000 Domainoid score I1287
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 188 1.000 Inparanoid score I1398
OMA 1 1.010 - - QHG54223
OrthoDB 1 1.010 - - D1378291at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3424
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1636
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.840

Return to query results.
Submit another query.