DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dak1 and AT3G60180

DIOPT Version :9

Sequence 1:NP_651456.1 Gene:Dak1 / 43165 FlyBaseID:FBgn0028833 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_567093.1 Gene:AT3G60180 / 825188 AraportID:AT3G60180 Length:204 Species:Arabidopsis thaliana


Alignment Length:193 Identity:91/193 - (47%)
Similarity:130/193 - (67%) Gaps:12/193 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 EKPKIVFVLGGPGAGKGTQCSRIVDRFQFTHLSAGDLLREERSREGSEFGNLIEDYIRNGKIVPV 125
            :|..:||||||||:||||||:.:|..|.:||.|||||||.| .:.|||||.:|:..|..|:|||.
plant    19 KKSTVVFVLGGPGSGKGTQCANVVKHFSYTHFSAGDLLRAE-IKSGSEFGAMIQSMIAEGRIVPS 82

  Fly   126 EVTCSLLENAMKASGKSRFLIDGFPRNQDNLDGWNRQMSE---KVDFQFVLFFDCGEDVCVKRCL 187
            |:|..||..||:.||..:|||||||||::     ||.:.|   :::..|||||||.|:...:|.:
plant    83 EITVKLLCKAMEESGNDKFLIDGFPRNEE-----NRNVFENVARIEPAFVLFFDCPEEELERRIM 142

  Fly   188 GRGQSGSGRTDDNLDSLKKRISTYNNDSLPIIKFFEGAGQVKRIDASPDAEEVFGEVEKIFVA 250
            .|.|   ||.|||::::|||...:...:||||.::|..|::::|:|:..:||||..|..:|.:
plant   143 SRNQ---GREDDNIETIKKRFKVFVESTLPIISYYESKGKLRKINAAKSSEEVFEAVRVLFAS 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dak1NP_651456.1 UMP_CMP_kin_fam 65..249 CDD:273576 89/186 (48%)
ADK 65..240 CDD:238713 85/177 (48%)
AT3G60180NP_567093.1 UMP_CMP_kin_fam 23..201 CDD:273576 89/186 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 158 1.000 Domainoid score I1287
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 188 1.000 Inparanoid score I1398
OMA 1 1.010 - - QHG54223
OrthoDB 1 1.010 - - D1378291at2759
OrthoFinder 1 1.000 - - FOG0002780
OrthoInspector 1 1.000 - - otm3424
orthoMCL 1 0.900 - - OOG6_100591
Panther 1 1.100 - - O PTHR23359
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1636
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.