DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dak1 and cmpk1

DIOPT Version :9

Sequence 1:NP_651456.1 Gene:Dak1 / 43165 FlyBaseID:FBgn0028833 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001263603.1 Gene:cmpk1 / 733534 XenbaseID:XB-GENE-980040 Length:219 Species:Xenopus tropicalis


Alignment Length:216 Identity:119/216 - (55%)
Similarity:155/216 - (71%) Gaps:8/216 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 RFITTTSTAPPHNIGIMSVEKPKIVFVLGGPGAGKGTQCSRIVDRFQFTHLSAGDLLREERSREG 106
            |.:...|.|..|:  :..:.||.:|||||||||||||||.|||.::.:||||||||||:||.:..
 Frog     7 RTLPRISAASFHS--VRQIMKPFVVFVLGGPGAGKGTQCERIVQKYGYTHLSAGDLLRDERKKPD 69

  Fly   107 SEFGNLIEDYIRNGKIVPVEVTCSLLENAMKAS-----GKSRFLIDGFPRNQDNLDGWNRQMSEK 166
            |::|.|||.|||:|:|||||:|.|||:.||:.:     .|.:|||||||||:|||.||.|.|:.|
 Frog    70 SQYGELIESYIRDGRIVPVEITISLLQRAMEQTMALDGNKHKFLIDGFPRNEDNLQGWERTMNGK 134

  Fly   167 VDFQFVLFFDCGEDVCVKRCLGRGQSGSGRTDDNLDSLKKRISTYNNDSLPIIKFFEGAGQVKRI 231
            .|..|||||||..:.|::|||.||:| |||:|||.:||:|||.||...:.|||..:|..|:||::
 Frog   135 ADVSFVLFFDCDNETCIERCLERGKS-SGRSDDNRESLEKRIQTYLQSTRPIIDLYEKTGKVKKV 198

  Fly   232 DASPDAEEVFGEVEKIFVASG 252
            |||...:|||.:|:.||...|
 Frog   199 DASKSVDEVFTKVQDIFDREG 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dak1NP_651456.1 UMP_CMP_kin_fam 65..249 CDD:273576 111/188 (59%)
ADK 65..240 CDD:238713 106/179 (59%)
cmpk1NP_001263603.1 UMP_CMP_kin_fam 28..216 CDD:273576 111/188 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 204 1.000 Domainoid score I2876
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H32308
Inparanoid 1 1.050 239 1.000 Inparanoid score I3273
OMA 1 1.010 - - QHG54223
OrthoDB 1 1.010 - - D1378291at2759
OrthoFinder 1 1.000 - - FOG0002780
OrthoInspector 1 1.000 - - otm48423
Panther 1 1.100 - - LDO PTHR23359
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1604
SonicParanoid 1 1.000 - - X1636
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1212.200

Return to query results.
Submit another query.