Sequence 1: | NP_651456.1 | Gene: | Dak1 / 43165 | FlyBaseID: | FBgn0028833 | Length: | 253 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001357742.1 | Gene: | Ak9 / 633979 | MGIID: | 2685080 | Length: | 1879 | Species: | Mus musculus |
Alignment Length: | 196 | Identity: | 40/196 - (20%) |
---|---|---|---|
Similarity: | 84/196 - (42%) | Gaps: | 24/196 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 60 VEKPKIVFVLGGPGAGKGTQCSRIVDRFQFTHLSAGDLLREERSREGSEFGNLIEDYIRNGKIVP 124
Fly 125 VEVTCSLLENAMKASGKSRF--LIDGFPR-NQDNLDGWNR-QMSEKVDFQ--FVLFFDCGE-DVC 182
Fly 183 VKRCLGRGQSGSGRT-------DDNLDSLKKRISTYNNDSLPIIKFFEGAGQVKRIDASPDAEEV 240
Fly 241 F 241 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Dak1 | NP_651456.1 | UMP_CMP_kin_fam | 65..249 | CDD:273576 | 38/191 (20%) |
ADK | 65..240 | CDD:238713 | 36/188 (19%) | ||
Ak9 | NP_001357742.1 | adk | 34..286 | CDD:273569 | 38/190 (20%) |
Ribosomal_L24e_L24 | <926..956 | CDD:382277 | |||
ADK | 962..1177 | CDD:238713 | |||
ADK | 1381..1553 | CDD:238713 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0563 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |