DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dak1 and Ak9

DIOPT Version :9

Sequence 1:NP_651456.1 Gene:Dak1 / 43165 FlyBaseID:FBgn0028833 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001357742.1 Gene:Ak9 / 633979 MGIID:2685080 Length:1879 Species:Mus musculus


Alignment Length:196 Identity:40/196 - (20%)
Similarity:84/196 - (42%) Gaps:24/196 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 VEKPKIVFVLGGPGAGKGTQCSRIVDRFQFTHLSAGDLLREERSREGSEFGNLIEDYIRNGKIVP 124
            :.||....:.|.|||||.|....|...::...:.|..:|.|..:.| .|.|.:::..:.:|..:|
Mouse    28 LSKPTCFIIFGKPGAGKTTLARNIAQAWKCIRVEALSVLEEHIAAE-KETGAMLQSLLVSGHSIP 91

  Fly   125 VEVTCSLLENAMKASGKSRF--LIDGFPR-NQDNLDGWNR-QMSEKVDFQ--FVLFFDCGE-DVC 182
            .|:...|:...:|:...:.|  ::...|. .|||:....: ::.:.::.|  .::...|.: |:|
Mouse    92 DELVTKLILEKIKSPEVAHFGYILTEMPSLAQDNMTSLKQIELVKNLELQPDIIINIKCSDYDLC 156

  Fly   183 VKRCLGRGQSGSGRT-------DDNLDSLKKRISTYNNDSLPIIKFFEGAGQVKRIDASPDAEEV 240
            .:.|..|..|.:|..       .:.::|.:::...:..         ||..:.:..:...:.||.
Mouse   157 QRTCGQRQHSTTGYVYTREQWDPEIIESRRRKKRDFPK---------EGKSEEEEEEEEQEEEEA 212

  Fly   241 F 241
            |
Mouse   213 F 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dak1NP_651456.1 UMP_CMP_kin_fam 65..249 CDD:273576 38/191 (20%)
ADK 65..240 CDD:238713 36/188 (19%)
Ak9NP_001357742.1 adk 34..286 CDD:273569 38/190 (20%)
Ribosomal_L24e_L24 <926..956 CDD:382277
ADK 962..1177 CDD:238713
ADK 1381..1553 CDD:238713
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.