DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dak1 and AT3G60961

DIOPT Version :9

Sequence 1:NP_651456.1 Gene:Dak1 / 43165 FlyBaseID:FBgn0028833 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001118870.1 Gene:AT3G60961 / 6241017 AraportID:AT3G60961 Length:136 Species:Arabidopsis thaliana


Alignment Length:141 Identity:55/141 - (39%)
Similarity:88/141 - (62%) Gaps:15/141 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 IRNGKIVPVEVT----CSLLENAMKASGKSRFLIDGFPRNQDNLDGWNRQMSE---KVDFQFVLF 174
            |..|:|||.|:|    |..:|.:.:.||..:|||||||||::     ||.:.|   :::..||||
plant     2 IAEGRIVPSEITVKLLCKAMEESFQVSGNDKFLIDGFPRNEE-----NRIVFENVARIEPAFVLF 61

  Fly   175 FDCGEDVCVKRCLGRGQSGSGRTDDNLDSLKKRISTYNNDSLPIIKFFEGAGQVKRIDASPDAEE 239
            |||.|:...:|.:.|.|   ||.|||::::|||...:...:||||.:::..|::::|:|:..:||
plant    62 FDCPEEELERRIMSRNQ---GREDDNIETIKKRFKVFVESTLPIISYYQSKGKLRKINAAKSSEE 123

  Fly   240 VFGEVEKIFVA 250
            ||..|..:|.:
plant   124 VFEAVRVLFAS 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dak1NP_651456.1 UMP_CMP_kin_fam 65..249 CDD:273576 54/138 (39%)
ADK 65..240 CDD:238713 50/129 (39%)
AT3G60961NP_001118870.1 ADK <1..124 CDD:238713 50/129 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 158 1.000 Domainoid score I1287
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54223
OrthoDB 1 1.010 - - D1378291at2759
OrthoFinder 1 1.000 - - FOG0002780
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23359
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1636
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.890

Return to query results.
Submit another query.