DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dak1 and ak9

DIOPT Version :9

Sequence 1:NP_651456.1 Gene:Dak1 / 43165 FlyBaseID:FBgn0028833 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_685909.5 Gene:ak9 / 557708 ZFINID:ZDB-GENE-041014-337 Length:1762 Species:Danio rerio


Alignment Length:258 Identity:42/258 - (16%)
Similarity:89/258 - (34%) Gaps:77/258 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 VEKPKIVFVLGGPGAGKGTQCSRIVDRFQFTHLSAGDLLREERSREGSEFGNLIEDYIRNGKIVP 124
            :.||....::|.||.||.|...:|...:....:...|:|....:.| ::.|..:...:..||.||
Zfish    27 LSKPACFIIIGKPGVGKSTLAKKIAKTWNCILIDDTDVLNNHINNE-TDQGKQLFRILAEGKAVP 90

  Fly   125 VEVTCSLLENAMKASGKSRF---------LIDGFPRNQDNLDGWNRQMSEKVDFQFVLFFDCGED 180
            .|:..:|:.:.:|:.....:         :.:.:.:.|:.:|   ...:.|:...|::...|.:.
Zfish    91 EEMMVNLIVDRLKSPDIKHYGYVLACLPSISEEYMKIQEQID---LIKTLKMSPDFIINIKCADR 152

  Fly   181 VCVKR-----------CL------------------------GRGQSGSGRTDDNL--------- 201
            ..::|           |:                        ...:.|...|.::|         
Zfish   153 DLIRRLSEERQHPETGCVFPKEKWDPDKKESLMKQSNMEEEEEEEEEGEEETTEDLEVEEIEEIQ 217

  Fly   202 -----------------DSLKKRISTYNNDSL-PIIKFFEGAG--QVKRIDASPDAEEVFGEV 244
                             :::..||..|.::.| |:..:..|..  .:..:|.:.|.||:|..|
Zfish   218 LQKDVIAQLVRVTENYPENVTSRIKCYKDNILRPLEDYMAGHNPPYLFELDGNTDPEELFESV 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dak1NP_651456.1 UMP_CMP_kin_fam 65..249 CDD:273576 40/253 (16%)
ADK 65..240 CDD:238713 37/247 (15%)
ak9XP_685909.5 adk 33..280 CDD:273569 39/250 (16%)
ADK 33..276 CDD:238713 37/246 (15%)
AAA_17 394..504 CDD:289950
DUF3508 <717..804 CDD:288841
Ribosomal_L24e_L24 <775..808 CDD:294589
NK 816..>983 CDD:302627
Adk 1258..1445 CDD:223637
ADK 1258..1432 CDD:238713
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.