DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dak1 and ak5l

DIOPT Version :9

Sequence 1:NP_651456.1 Gene:Dak1 / 43165 FlyBaseID:FBgn0028833 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001017540.1 Gene:ak5l / 548336 ZFINID:ZDB-GENE-050410-2 Length:335 Species:Danio rerio


Alignment Length:254 Identity:73/254 - (28%)
Similarity:126/254 - (49%) Gaps:31/254 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GSPGVGLAP----SALTQHQLRHSKASNRFITTTS-TAPPHNIGIMSVEKPKIVFVLGGPGAGKG 77
            |.||.|..|    ..|...|.:.|..|:..:|.:| ....:::...|..:|.|:|::||||:|||
Zfish    84 GGPGPGPGPYRRYDRLPPIQAQFSIESDSDMTESSGLIQEYDVFDPSKPRPHIIFIIGGPGSGKG 148

  Fly    78 TQCSRIVDRFQFTHLSAGDLLREE--RSREGSEFGNLIEDYIRNGKIVPVEVTC-SLLENAMKAS 139
            ||.::|..|:.|.|:|.|::||.:  ..........||...|.||::.|.|.|. .|.:..:|..
Zfish   149 TQTAKIALRYDFEHVSVGEILRNQLLHHAPSDRKWELIAQIIANGELAPQETTIEELKQQFIKKQ 213

  Fly   140 GKSRFLIDGFPRNQDNLDGWNRQMSEKVDFQ-------FVLFFDCGEDVCVKRCLGRGQSGSGRT 197
            ....|::||||          |::|:...|:       .|:...|......:| |.:..|..||.
Zfish   214 DAKGFIVDGFP----------REISQAFTFEEQIGSPDLVILLACSNQQLRQR-LEKRASQQGRP 267

  Fly   198 DDNLDSLKKRISTYNNDSLPIIKFFEGAGQVKRIDASPDAEEVFGEV-----EKIFVAS 251
            |||..:::||:.|:.::...|.|:::..|.:.|:||..:.:::|.::     |::|.:|
Zfish   268 DDNSHAIEKRLDTFKHNINLIAKYYQERGLIVRVDADREEDDIFTDISAIVKERLFPSS 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dak1NP_651456.1 UMP_CMP_kin_fam 65..249 CDD:273576 58/198 (29%)
ADK 65..240 CDD:238713 56/184 (30%)
ak5lNP_001017540.1 aden_kin_iso1 136..314 CDD:130427 57/188 (30%)
ADK 136..310 CDD:238713 56/184 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1378291at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.