DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dak1 and CMPK1

DIOPT Version :9

Sequence 1:NP_651456.1 Gene:Dak1 / 43165 FlyBaseID:FBgn0028833 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_057392.1 Gene:CMPK1 / 51727 HGNCID:18170 Length:228 Species:Homo sapiens


Alignment Length:196 Identity:116/196 - (59%)
Similarity:147/196 - (75%) Gaps:6/196 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 KPKIVFVLGGPGAGKGTQCSRIVDRFQFTHLSAGDLLREERSREGSEFGNLIEDYIRNGKIVPVE 126
            ||.:|||||||||||||||:|||:::.:||||||:|||:||....|::|.|||.||:.|||||||
Human    34 KPLVVFVLGGPGAGKGTQCARIVEKYGYTHLSAGELLRDERKNPDSQYGELIEKYIKEGKIVPVE 98

  Fly   127 VTCSLLENAMKA-----SGKSRFLIDGFPRNQDNLDGWNRQMSEKVDFQFVLFFDCGEDVCVKRC 186
            :|.|||:..|..     :.|::|||||||||||||.|||:.|..|.|..|||||||..::|::||
Human    99 ITISLLKREMDQTMAANAQKNKFLIDGFPRNQDNLQGWNKTMDGKADVSFVLFFDCNNEICIERC 163

  Fly   187 LGRGQSGSGRTDDNLDSLKKRISTYNNDSLPIIKFFEGAGQVKRIDASPDAEEVFGEVEKIFVAS 251
            |.||:| |||:|||.:||:|||.||...:.|||..:|..|:||:||||...:|||.||.:||...
Human   164 LERGKS-SGRSDDNRESLEKRIQTYLQSTKPIIDLYEEMGKVKKIDASKSVDEVFDEVVQIFDKE 227

  Fly   252 G 252
            |
Human   228 G 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dak1NP_651456.1 UMP_CMP_kin_fam 65..249 CDD:273576 112/188 (60%)
ADK 65..240 CDD:238713 106/179 (59%)
CMPK1NP_057392.1 UMP_CMP_kin_fam 37..225 CDD:273576 112/188 (60%)
ADK 37..216 CDD:238713 106/179 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 202 1.000 Domainoid score I2999
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H32308
Inparanoid 1 1.050 237 1.000 Inparanoid score I3390
Isobase 1 0.950 - 0 Normalized mean entropy S511
OMA 1 1.010 - - QHG54223
OrthoDB 1 1.010 - - D1378291at2759
OrthoFinder 1 1.000 - - FOG0002780
OrthoInspector 1 1.000 - - oto89766
orthoMCL 1 0.900 - - OOG6_100591
Panther 1 1.100 - - LDO PTHR23359
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1604
SonicParanoid 1 1.000 - - X1636
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.820

Return to query results.
Submit another query.