Sequence 1: | NP_651456.1 | Gene: | Dak1 / 43165 | FlyBaseID: | FBgn0028833 | Length: | 253 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_057366.2 | Gene: | AK3 / 50808 | HGNCID: | 17376 | Length: | 227 | Species: | Homo sapiens |
Alignment Length: | 207 | Identity: | 55/207 - (26%) |
---|---|---|---|
Similarity: | 98/207 - (47%) | Gaps: | 39/207 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 68 VLGGPGAGKGTQCSRIVDRFQFTHLSAGDLLREERSREGSEFGNLIEDYIRNGKIVPVEVTCSLL 132
Fly 133 ENAMKASGKSRFLIDGFPRNQDNLDGWNRQMSEKVDFQFVLFFDCGEDVCVKRCLGR-------- 189
Fly 190 ------------------GQSGSGRTDDNLDSLKKRISTYNNDSLPIIKFFEGAGQVKRIDASPD 236
Fly 237 AEEVFGEVEKIF 248 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Dak1 | NP_651456.1 | UMP_CMP_kin_fam | 65..249 | CDD:273576 | 55/207 (27%) |
ADK | 65..240 | CDD:238713 | 52/197 (26%) | ||
AK3 | NP_057366.2 | ADK | 12..190 | CDD:395329 | 51/182 (28%) |
NMP. /evidence=ECO:0000255|HAMAP-Rule:MF_03169, ECO:0000269|Ref.10 | 37..66 | 14/29 (48%) | |||
LID. /evidence=ECO:0000255|HAMAP-Rule:MF_03169, ECO:0000269|Ref.10 | 127..164 | 3/36 (8%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0563 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |