DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dak1 and ak1

DIOPT Version :9

Sequence 1:NP_651456.1 Gene:Dak1 / 43165 FlyBaseID:FBgn0028833 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_031746217.1 Gene:ak1 / 448536 XenbaseID:XB-GENE-1012039 Length:566 Species:Xenopus tropicalis


Alignment Length:197 Identity:79/197 - (40%)
Similarity:120/197 - (60%) Gaps:7/197 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 APPHNIGIMSVEKPKIVFVLGGPGAGKGTQCSRIVDRFQFTHLSAGDLLREERSREGSEFGNLIE 114
            :|.|......::..||:||:||||:||||||.:||.::.:||||.|||||.|.| .|||.|..:.
 Frog   367 SPEHTEMADKLKNSKIIFVVGGPGSGKGTQCEKIVHQYGYTHLSTGDLLRAEVS-SGSERGKHLS 430

  Fly   115 DYIRNGKIVPVEVTCSLLENAM--KASGKSRFLIDGFPRNQDNLDGWNRQMSEKVDFQFVLFFDC 177
            ..:..|::||::....:|:.||  ||.....:||||:||.....:.:.:::...   ..:|:.|.
 Frog   431 AIMEKGELVPLDTVLDMLKEAMIAKADTSKGYLIDGYPREVKQGEEFEKKIGPP---SLLLYIDA 492

  Fly   178 GEDVCVKRCLGRGQSGSGRTDDNLDSLKKRISTYNNDSLPIIKFFEGAGQVKRIDASPDAEEVFG 242
            |.|..|||.|.||:: |||.|||..::|||:.||...:.|:|..:||.|.|::|:|....::||.
 Frog   493 GSDTMVKRLLKRGET-SGRADDNEATIKKRLETYYKATEPVIAMYEGRGIVRKINAEGSVDDVFK 556

  Fly   243 EV 244
            :|
 Frog   557 QV 558

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dak1NP_651456.1 UMP_CMP_kin_fam 65..249 CDD:273576 76/182 (42%)
ADK 65..240 CDD:238713 73/176 (41%)
ak1XP_031746217.1 aden_kin_iso1 129..312 CDD:130427
aden_kin_iso1 378..565 CDD:130427 77/186 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1378291at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.