Sequence 1: | NP_651456.1 | Gene: | Dak1 / 43165 | FlyBaseID: | FBgn0028833 | Length: | 253 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_998464.1 | Gene: | ak4 / 406590 | ZFINID: | ZDB-GENE-040426-2505 | Length: | 226 | Species: | Danio rerio |
Alignment Length: | 195 | Identity: | 51/195 - (26%) |
---|---|---|---|
Similarity: | 79/195 - (40%) | Gaps: | 51/195 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 68 VLGGPGAGKGTQCSRIVDRFQFTHLSAGDLLREERSREGSEFGNLIEDYIRNGKIVPVEVTCSLL 132
Fly 133 ENAMKASGKSRFLIDGFPRNQDNLDGWNRQMSEKVDFQFVLFFDCGEDVCVKRCL---------- 187
Fly 188 --------GR------------------GQSGSGRTDDNLDSLKKRISTYNNDSLPIIKFFEGAG 226
Fly 227 226 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Dak1 | NP_651456.1 | UMP_CMP_kin_fam | 65..249 | CDD:273576 | 51/195 (26%) |
ADK | 65..240 | CDD:238713 | 51/195 (26%) | ||
ak4 | NP_998464.1 | adk | 6..210 | CDD:273569 | 51/195 (26%) |
ADK | 6..192 | CDD:238713 | 51/195 (26%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0563 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |