DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dak1 and cmpk

DIOPT Version :9

Sequence 1:NP_651456.1 Gene:Dak1 / 43165 FlyBaseID:FBgn0028833 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_998274.2 Gene:cmpk / 406383 ZFINID:ZDB-GENE-040426-2113 Length:219 Species:Danio rerio


Alignment Length:200 Identity:121/200 - (60%)
Similarity:153/200 - (76%) Gaps:8/200 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 HNIGIMSVEKPKIVFVLGGPGAGKGTQCSRIVDRFQFTHLSAGDLLREERSREGSEFGNLIEDYI 117
            |.:.:  :.||::|||||||||||||||:|||:.:.:|||||||||||||||..||||.||:.||
Zfish    18 HRLRV--IMKPQVVFVLGGPGAGKGTQCARIVENYSYTHLSAGDLLREERSRTDSEFGQLIDSYI 80

  Fly   118 RNGKIVPVEVTCSLLENAMKASGKS-----RFLIDGFPRNQDNLDGWNRQMSEKVDFQFVLFFDC 177
            :.||||||::|.:||..||:.:.|:     ||||||||||||||.|||.:|..|.|.:|||||||
Zfish    81 KEGKIVPVQITINLLRKAMEETMKADEKKFRFLIDGFPRNQDNLQGWNTEMDGKADVKFVLFFDC 145

  Fly   178 GEDVCVKRCLGRGQSGSGRTDDNLDSLKKRISTYNNDSLPIIKFFEGAGQVKRIDASPDAEEVFG 242
            ..:||:.|||.||:| |||||||.:||:|||.||...:.|||:.:|..|:|:|||||...:|||.
Zfish   146 SNEVCIDRCLERGKS-SGRTDDNRESLEKRIQTYLQSTRPIIELYEKQGKVQRIDASRSVDEVFA 209

  Fly   243 EVEKI 247
            :|:.|
Zfish   210 DVKNI 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dak1NP_651456.1 UMP_CMP_kin_fam 65..249 CDD:273576 117/187 (63%)
ADK 65..240 CDD:238713 113/179 (63%)
cmpkNP_998274.2 UMP_CMP_kin_fam 28..215 CDD:273576 117/187 (63%)
ADK 28..207 CDD:238713 113/179 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593090
Domainoid 1 1.000 213 1.000 Domainoid score I2712
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H32308
Inparanoid 1 1.050 244 1.000 Inparanoid score I3274
OMA 1 1.010 - - QHG54223
OrthoDB 1 1.010 - - D1378291at2759
OrthoFinder 1 1.000 - - FOG0002780
OrthoInspector 1 1.000 - - oto39539
orthoMCL 1 0.900 - - OOG6_100591
Panther 1 1.100 - - LDO PTHR23359
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1604
SonicParanoid 1 1.000 - - X1636
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.900

Return to query results.
Submit another query.