DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dak1 and ak7a

DIOPT Version :9

Sequence 1:NP_651456.1 Gene:Dak1 / 43165 FlyBaseID:FBgn0028833 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001166036.1 Gene:ak7a / 402854 ZFINID:ZDB-GENE-040724-122 Length:696 Species:Danio rerio


Alignment Length:238 Identity:49/238 - (20%)
Similarity:90/238 - (37%) Gaps:61/238 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 PKIVFVLGGPGAGKGTQCSRIVDRFQFTHLSAGD------------LLREERSREGSEFGNLIED 115
            |..:.:||.|..||.|....:...::..|::..:            |.|.|::.|..|..:..|:
Zfish   356 PIKICLLGPPAVGKSTVAEELCKYYKLNHVTVDEAVSEKIRQLEELLERNEKTAENEELLSAAEE 420

  Fly   116 YIR---------NGKIVPVEVTCSLLE--NAMKASGKSRFLIDGFPR------------NQDNLD 157
            .::         .|::...::...::|  |:|....:. |::||:|:            |.:..|
Zfish   421 KLKAIKNSMLQNGGQLDNQQIIHIIMEKLNSMPCRNQG-FVLDGYPKTYSQANELFQDENMEVED 484

  Fly   158 G------WNRQMSEKVDFQFVLFFDCGEDVCVKRCLGRGQSGSG----RTDDNLDSLKKRISTYN 212
            |      :|:.|..    :||...|..:|....|.....|:.:.    ..::..|||.|...|..
Zfish   485 GRATEPKYNKVMIP----EFVFSLDATDDFLKARVRSLPQNVAEMKHYTQEEFTDSLAKFRQTLA 545

  Fly   213 NDSLPIIKFFEGAGQVKRIDASP---DAEEVFGEVEKIFVASG 252
            .|. .::.:|:      .::..|   |.|.| ..||||....|
Zfish   546 EDE-SVLDYFD------ELEIHPEHIDCENV-AVVEKIIKTVG 580

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dak1NP_651456.1 UMP_CMP_kin_fam 65..249 CDD:273576 47/231 (20%)
ADK 65..240 CDD:238713 42/222 (19%)
ak7aNP_001166036.1 NADB_Rossmann <162..288 CDD:304358
WcaG <208..288 CDD:223528
ADK 358..568 CDD:238713 41/221 (19%)
Dpy-30 653..694 CDD:253069
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.