DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dak1 and CG9541

DIOPT Version :9

Sequence 1:NP_651456.1 Gene:Dak1 / 43165 FlyBaseID:FBgn0028833 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001260273.1 Gene:CG9541 / 34220 FlyBaseID:FBgn0032083 Length:646 Species:Drosophila melanogaster


Alignment Length:225 Identity:52/225 - (23%)
Similarity:106/225 - (47%) Gaps:35/225 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 ITTTSTAPPHNIGIMSVEKPK----------------IVFVLGGPGAGKGTQCSRIVD-RFQFTH 91
            :.|.:|:...:.|::..::||                |::|:||||:.|.|.|.:.|. ...:.|
  Fly   322 LKTGTTSADDDSGVVVTQQPKLRQAAGPDESGSDLPPIIWVIGGPGSNKATLCLKAVGLNPGWAH 386

  Fly    92 LSAGDLLR---EERSREGSEFGNLIEDYIRNGKIVPVEVTCSLLE-NAMKASGKSRFLIDGFPRN 152
            :|.|.|||   :...|..:| ...:::.:..|.:.|.:....||| |..:...::..::||:|||
  Fly   387 ISVGRLLRNITDSAPRANTE-SFAVKEALAAGDMAPEKSLNQLLETNLRQLRDRTGIIVDGYPRN 450

  Fly   153 QDNLDGWNRQMSEKVDFQFVLFFDCGEDVCVKRCLGRGQSGSGRTDDNLDSLKKRISTYNNDSLP 217
            ...:..:..:..::..   ::..||          .:.|.|.||.||.:.|.::|:..:...:||
  Fly   451 LQQVKYFENKYKQRPP---IILLDC----------SKLQLGRGRIDDTVSSFRRRLELFREQTLP 502

  Fly   218 IIKFFEGAGQVKRIDASPDAEEVFGEVEKI 247
            ::|..:.:.:::.:|...|:..|..|.|::
  Fly   503 MLKILDTSNRLQIVDGDTDSPSVQREFERL 532

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dak1NP_651456.1 UMP_CMP_kin_fam 65..249 CDD:273576 47/188 (25%)
ADK 65..240 CDD:238713 44/179 (25%)
CG9541NP_001260273.1 aden_kin_iso1 67..238 CDD:130427
ADK 70..230 CDD:238713
aden_kin_iso1 358..521 CDD:130427 43/176 (24%)
ADK 359..521 CDD:238713 43/175 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451277
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S511
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1378291at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23359
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.800

Return to query results.
Submit another query.