DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dak1 and ak2

DIOPT Version :9

Sequence 1:NP_651456.1 Gene:Dak1 / 43165 FlyBaseID:FBgn0028833 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_997761.1 Gene:ak2 / 321793 ZFINID:ZDB-GENE-030131-512 Length:241 Species:Danio rerio


Alignment Length:225 Identity:66/225 - (29%)
Similarity:110/225 - (48%) Gaps:33/225 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 IMSVEKPKIVFVLGGPGAGKGTQCSRIVDRFQFTHLSAGDLLREERSREGSEFGNLIEDYIRNGK 121
            :..:.|.....:||.||||||||..::.:::...||:.||:|| .....|||.|..:::.:..||
Zfish    11 VSGIRKGIRAILLGPPGAGKGTQAPKLAEKYCVCHLATGDMLR-AMVASGSELGQRLKETMDAGK 74

  Fly   122 IVPVEVTCSLLENAMKA-SGKSRFLIDGFPR---NQDNLDGWNRQMSEKVDFQFVLFFDCGEDVC 182
            :|..|:...|::|.:.. |.|:.||:|||||   ..:.||....:.|||:|  .|:.|...:.:.
Zfish    75 LVSDEMVVELIDNNLDTPSCKNGFLLDGFPRTVKQAEMLDDLMEKRSEKLD--SVIEFSVDDSLL 137

  Fly   183 VKRCLGR--------------------------GQSGSGRTDDNLDSLKKRISTYNNDSLPIIKF 221
            |:|..||                          |:....|:|||..:|:.|:.:|:..:.|::::
Zfish   138 VRRICGRLIHQPSGRSYHEEFHPPKEHMKDDVTGEPLIRRSDDNETTLRSRLESYHRQTSPLVQY 202

  Fly   222 FEGAGQVKRIDASPDAEEVFGEVEKIFVAS 251
            :...|....||||...:.||..:...|.|:
Zfish   203 YSARGLHTAIDASQSTDLVFASILAAFSAA 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dak1NP_651456.1 UMP_CMP_kin_fam 65..249 CDD:273576 63/213 (30%)
ADK 65..240 CDD:238713 61/204 (30%)
ak2NP_997761.1 adk 19..231 CDD:234711 64/214 (30%)
ADK 19..221 CDD:238713 61/204 (30%)
NMP. /evidence=ECO:0000255|HAMAP-Rule:MF_03168 47..76 10/29 (34%)
LID. /evidence=ECO:0000255|HAMAP-Rule:MF_03168 143..180 4/36 (11%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 152..180 2/27 (7%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.