DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dak1 and Ak4

DIOPT Version :9

Sequence 1:NP_651456.1 Gene:Dak1 / 43165 FlyBaseID:FBgn0028833 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_058831.1 Gene:Ak4 / 29223 RGDID:2078 Length:223 Species:Rattus norvegicus


Alignment Length:206 Identity:51/206 - (24%)
Similarity:91/206 - (44%) Gaps:30/206 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 VLGGPGAGKGTQCSRIVDRFQFTHLSAGDLLREERSREGSEFGNLIEDYIRNGKIVPVEVTCSLL 132
            :||.||:||||.|.||...|...|||:|.||| |..:..:|.|::.:.|:..|.:||..|...|:
  Rat    10 ILGPPGSGKGTVCERIAQNFGLQHLSSGHLLR-ENLKTNTEVGDVAKQYLEKGLLVPDHVITRLM 73

  Fly   133 ENAMKASGKSRFLIDGFPRNQDNLDGWNRQMSEKVDFQFVLFFDCGEDVCVKRCLGRGQSGSGRT 197
            .:.::......:|:|||||.....:..:|.....:.....:.|:..:|...:|.:   ...|||.
  Rat    74 MSELETRSAQHWLLDGFPRTLVQAEALDRICDVDLVISLNIPFETLKDRLSRRWI---HPSSGRV 135

  Fly   198 -------------------------DDNLDSLKKRISTYNNDSLPIIKFFEGAGQVKRIDASPDA 237
                                     ||..::|..|:..|.:.:.|:|:.::..|.:.:...: :.
  Rat   136 YNLDFNPPQVLGVDDITGEPLVQQEDDKPEALAARLRRYKDAAKPVIELYKSRGVLHQFSGT-ET 199

  Fly   238 EEVFGEVEKIF 248
            ..::..|..:|
  Rat   200 NRIWPYVYTLF 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dak1NP_651456.1 UMP_CMP_kin_fam 65..249 CDD:273576 51/206 (25%)
ADK 65..240 CDD:238713 49/196 (25%)
Ak4NP_058831.1 adk 7..211 CDD:273569 51/206 (25%)
NMP. /evidence=ECO:0000255|HAMAP-Rule:MF_03170 35..64 10/29 (34%)
LID. /evidence=ECO:0000255|HAMAP-Rule:MF_03170 125..162 4/39 (10%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.