Sequence 1: | NP_651456.1 | Gene: | Dak1 / 43165 | FlyBaseID: | FBgn0028833 | Length: | 253 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_058831.1 | Gene: | Ak4 / 29223 | RGDID: | 2078 | Length: | 223 | Species: | Rattus norvegicus |
Alignment Length: | 206 | Identity: | 51/206 - (24%) |
---|---|---|---|
Similarity: | 91/206 - (44%) | Gaps: | 30/206 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 68 VLGGPGAGKGTQCSRIVDRFQFTHLSAGDLLREERSREGSEFGNLIEDYIRNGKIVPVEVTCSLL 132
Fly 133 ENAMKASGKSRFLIDGFPRNQDNLDGWNRQMSEKVDFQFVLFFDCGEDVCVKRCLGRGQSGSGRT 197
Fly 198 -------------------------DDNLDSLKKRISTYNNDSLPIIKFFEGAGQVKRIDASPDA 237
Fly 238 EEVFGEVEKIF 248 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Dak1 | NP_651456.1 | UMP_CMP_kin_fam | 65..249 | CDD:273576 | 51/206 (25%) |
ADK | 65..240 | CDD:238713 | 49/196 (25%) | ||
Ak4 | NP_058831.1 | adk | 7..211 | CDD:273569 | 51/206 (25%) |
NMP. /evidence=ECO:0000255|HAMAP-Rule:MF_03170 | 35..64 | 10/29 (34%) | |||
LID. /evidence=ECO:0000255|HAMAP-Rule:MF_03170 | 125..162 | 4/39 (10%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0563 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |