DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dak1 and Ak1

DIOPT Version :9

Sequence 1:NP_651456.1 Gene:Dak1 / 43165 FlyBaseID:FBgn0028833 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_038960159.1 Gene:Ak1 / 24183 RGDID:2076 Length:210 Species:Rattus norvegicus


Alignment Length:187 Identity:74/187 - (39%)
Similarity:119/187 - (63%) Gaps:7/187 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 VEKPKIVFVLGGPGAGKGTQCSRIVDRFQFTHLSAGDLLREERSREGSEFGNLIEDYIRNGKIVP 124
            ::|.||:||:||||:||||||.:||.::.:||||.|||||.|.| .||..|.::...:..|::||
  Rat    21 LKKAKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEVS-SGSSRGKMLSSIMEKGELVP 84

  Fly   125 VEVTCSLLENAM--KASGKSRFLIDGFPRNQDNLDGWNRQMSEKVDFQFVLFFDCGEDVCVKRCL 187
            :|....:|.:||  |....:.|||||:||.....:.:.|::::..   .:|:.|.|.:...:|.|
  Rat    85 LETVLDMLRDAMLAKVDSSNGFLIDGYPREVKQGEEFERKIAQPT---LLLYVDAGPETMTQRLL 146

  Fly   188 GRGQSGSGRTDDNLDSLKKRISTYNNDSLPIIKFFEGAGQVKRIDASPDAEEVFGEV 244
            .||:: |||.|||.:::|||:.||...:.|:|.|::..|.|::::|....:.||.:|
  Rat   147 KRGET-SGRVDDNEETIKKRLETYYKATEPVISFYDKRGIVRKVNAEGSVDTVFSQV 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dak1NP_651456.1 UMP_CMP_kin_fam 65..249 CDD:273576 72/182 (40%)
ADK 65..240 CDD:238713 69/176 (39%)
Ak1XP_038960159.1 aden_kin_iso1 22..209 CDD:130427 74/186 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54223
OrthoDB 1 1.010 - - D1378291at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100591
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.