DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dak1 and AK4

DIOPT Version :9

Sequence 1:NP_651456.1 Gene:Dak1 / 43165 FlyBaseID:FBgn0028833 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001005353.1 Gene:AK4 / 205 HGNCID:363 Length:223 Species:Homo sapiens


Alignment Length:203 Identity:48/203 - (23%)
Similarity:91/203 - (44%) Gaps:24/203 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 VLGGPGAGKGTQCSRIVDRFQFTHLSAGDLLREERSREGSEFGNLIEDYIRNGKIVPVEVTCSLL 132
            :||.||:||||.|.||...|...|||:|..|| |..:..:|.|.:.:.||....:||..|...|:
Human    10 ILGPPGSGKGTVCQRIAQNFGLQHLSSGHFLR-ENIKASTEVGEMAKQYIEKSLLVPDHVITRLM 73

  Fly   133 ENAMKASGKSRFLIDGFPRNQDNLDGWNRQMSEKVDFQFVLFFDCGEDVCVKRCL----GR---- 189
            .:.::......:|:|||||.....:..::.....:.....:.|:..:|...:|.:    ||    
Human    74 MSELENRRGQHWLLDGFPRTLGQAEALDKICEVDLVISLNIPFETLKDRLSRRWIHPPSGRVYNL 138

  Fly   190 --------------GQSGSGRTDDNLDSLKKRISTYNNDSLPIIKFFEGAGQVKRIDASPDAEEV 240
                          |:....:.||..:::..|:..|.:.:.|:|:.::..|.:.:...: :..::
Human   139 DFNPPHVHGIDDVTGEPLVQQEDDKPEAVAARLRQYKDVAKPVIELYKSRGVLHQFSGT-ETNKI 202

  Fly   241 FGEVEKIF 248
            :..|..:|
Human   203 WPYVYTLF 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dak1NP_651456.1 UMP_CMP_kin_fam 65..249 CDD:273576 48/203 (24%)
ADK 65..240 CDD:238713 46/193 (24%)
AK4NP_001005353.1 ADK 10..188 CDD:395329 45/178 (25%)
NMP. /evidence=ECO:0000255|HAMAP-Rule:MF_03170, ECO:0000269|PubMed:19073142 35..64 9/29 (31%)
LID. /evidence=ECO:0000255|HAMAP-Rule:MF_03170, ECO:0000269|PubMed:19073142 125..162 4/36 (11%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.