Sequence 1: | NP_651456.1 | Gene: | Dak1 / 43165 | FlyBaseID: | FBgn0028833 | Length: | 253 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001005353.1 | Gene: | AK4 / 205 | HGNCID: | 363 | Length: | 223 | Species: | Homo sapiens |
Alignment Length: | 203 | Identity: | 48/203 - (23%) |
---|---|---|---|
Similarity: | 91/203 - (44%) | Gaps: | 24/203 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 68 VLGGPGAGKGTQCSRIVDRFQFTHLSAGDLLREERSREGSEFGNLIEDYIRNGKIVPVEVTCSLL 132
Fly 133 ENAMKASGKSRFLIDGFPRNQDNLDGWNRQMSEKVDFQFVLFFDCGEDVCVKRCL----GR---- 189
Fly 190 --------------GQSGSGRTDDNLDSLKKRISTYNNDSLPIIKFFEGAGQVKRIDASPDAEEV 240
Fly 241 FGEVEKIF 248 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Dak1 | NP_651456.1 | UMP_CMP_kin_fam | 65..249 | CDD:273576 | 48/203 (24%) |
ADK | 65..240 | CDD:238713 | 46/193 (24%) | ||
AK4 | NP_001005353.1 | ADK | 10..188 | CDD:395329 | 45/178 (25%) |
NMP. /evidence=ECO:0000255|HAMAP-Rule:MF_03170, ECO:0000269|PubMed:19073142 | 35..64 | 9/29 (31%) | |||
LID. /evidence=ECO:0000255|HAMAP-Rule:MF_03170, ECO:0000269|PubMed:19073142 | 125..162 | 4/36 (11%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0563 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |