DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dak1 and F38B2.4

DIOPT Version :9

Sequence 1:NP_651456.1 Gene:Dak1 / 43165 FlyBaseID:FBgn0028833 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001257141.1 Gene:F38B2.4 / 181317 WormBaseID:WBGene00009531 Length:210 Species:Caenorhabditis elegans


Alignment Length:194 Identity:78/194 - (40%)
Similarity:118/194 - (60%) Gaps:8/194 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 NIGIMSVEKPKIVFVLGGPGAGKGTQCSRIVDRFQFTHLSAGDLLREERSREGSEFGNLIEDYIR 118
            |:..:......|.|::||||:||||||.:||.::..||||:|||||:| .:.||..|..:...:.
 Worm    11 NLAPLKAAGVPIFFIVGGPGSGKGTQCDKIVAKYGLTHLSSGDLLRDE-VKSGSPRGAQLTAIME 74

  Fly   119 NGKIVPVEVTCSLLENAM-KA--SGKSRFLIDGFPRNQDNLDGWNRQMSEKVDFQFVLFFDCGED 180
            :|.:||:||...|::.|| ||  .|...|||||:||.......:..::.|.   :.|||||..|:
 Worm    75 SGALVPLEVVLDLVKEAMLKAIEKGSKGFLIDGYPREVAQGQQFESEIQEA---KLVLFFDVAEE 136

  Fly   181 VCVKRCLGRGQSGSGRTDDNLDSLKKRISTYNNDSLPIIKFFEGAGQVKRIDASPDAEEVFGEV 244
            ..|||.|.|.|: |||.|||.|::|||:.|:...:.|::.::|..|::.||:|....:::|..|
 Worm   137 TLVKRLLHRAQT-SGRADDNADTIKKRLHTFVTSTAPVVDYYESKGKLVRINAEGSVDDIFAVV 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dak1NP_651456.1 UMP_CMP_kin_fam 65..249 CDD:273576 77/183 (42%)
ADK 65..240 CDD:238713 75/177 (42%)
F38B2.4NP_001257141.1 aden_kin_iso1 18..206 CDD:130427 77/187 (41%)
ADK 22..195 CDD:238713 75/177 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54223
OrthoDB 1 1.010 - - D1378291at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100591
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.