DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dak1 and ZK673.2

DIOPT Version :9

Sequence 1:NP_651456.1 Gene:Dak1 / 43165 FlyBaseID:FBgn0028833 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_496245.1 Gene:ZK673.2 / 174608 WormBaseID:WBGene00014058 Length:222 Species:Caenorhabditis elegans


Alignment Length:213 Identity:50/213 - (23%)
Similarity:94/213 - (44%) Gaps:40/213 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 VFVLGGPGAGKGTQCSRIVDRFQ---FTHLSAGDLLREERSREGSEFGNLIEDYIRNGKIVPVEV 127
            |.:.|..|:||||....:|..|:   |.:.:|||.:|:..:| |:|||...:.::..|:.||..:
 Worm     4 VLLSGAAGSGKGTIARMLVREFEPLGFNYFAAGDFIRDHIAR-GTEFGVRAQSFLNKGEHVPDSI 67

  Fly   128 -TCSLLENAMKASGKSRFLIDGFPRNQDNLDGWNRQMSEKVDFQFVLFFDCGEDVCVKR------ 185
             ..::|...:||.  .|.::||:|||...|    :.:.|:.....::.......|.:.|      
 Worm    68 LNGAILAEMLKAG--PRVVLDGYPRNMSQL----KMVEEQAPLNLIVELKVPRKVLIDRLSKQLV 126

  Fly   186 --CLGR------------------GQSGSGRTDDNLDSLKKRISTYNNDSLPIIKFFEGAGQVKR 230
              ..||                  |:....|:.|.|:..::|:..|:.....::.:::  .|.|.
 Worm   127 HPASGRAYNLEVNPPKEEGKDDITGEPLFKRSTDQLEVARRRLEVYDKTENKVLDYYK--KQNKC 189

  Fly   231 IDASPDAEE-VFGEVEKI 247
            |..|.::.: ||..|.::
 Worm   190 ITMSGESSKAVFESVAEV 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dak1NP_651456.1 UMP_CMP_kin_fam 65..249 CDD:273576 50/213 (23%)
ADK 65..240 CDD:238713 47/204 (23%)
ZK673.2NP_496245.1 adk 3..209 CDD:273569 50/213 (23%)
ADK 3..197 CDD:238713 47/201 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.