DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dak1 and Ak2

DIOPT Version :9

Sequence 1:NP_651456.1 Gene:Dak1 / 43165 FlyBaseID:FBgn0028833 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001029138.1 Gene:Ak2 / 11637 MGIID:87978 Length:239 Species:Mus musculus


Alignment Length:231 Identity:71/231 - (30%)
Similarity:108/231 - (46%) Gaps:37/231 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 APPHNIGIMSVEKPKIV--FVLGGPGAGKGTQCSRIVDRFQFTHLSAGDLLREERSREGSEFGNL 112
            ||  |:.....|.||.:  .:||.||||||||..::.:.|...||:.||:|| .....|||.|..
Mouse     2 AP--NVLASEPEIPKGIRAVLLGPPGAGKGTQAPKLAENFCVCHLATGDMLR-AMVASGSELGKK 63

  Fly   113 IEDYIRNGKIVPVEVTCSLLE-NAMKASGKSRFLIDGFP---RNQDNLDGWNRQMSEKVDFQFVL 173
            ::..:..||:|..|:...|:| |....|.|:.||:||||   |..:.||....:..||:|  .|:
Mouse    64 LKATMDAGKLVSDEMVVELIEKNLETPSCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLD--SVI 126

  Fly   174 FFDCGEDVCVKRCLGR--------------------------GQSGSGRTDDNLDSLKKRISTYN 212
            .|...:.:.::|..||                          |:....|:|||..:||.|:..|:
Mouse   127 EFSIQDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKTRLEAYH 191

  Fly   213 NDSLPIIKFFEGAGQVKRIDASPDAEEVFGEVEKIF 248
            ..:.|:::::...|....||||...:.||..:...|
Mouse   192 TQTTPLVEYYRKRGIHCAIDASQTPDIVFASILAAF 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dak1NP_651456.1 UMP_CMP_kin_fam 65..249 CDD:273576 65/216 (30%)
ADK 65..240 CDD:238713 62/206 (30%)
Ak2NP_001029138.1 ADK 17..219 CDD:238713 62/204 (30%)
ADK 20..204 CDD:278818 57/186 (31%)
NMP. /evidence=ECO:0000255|HAMAP-Rule:MF_03168 45..74 10/29 (34%)
LID. /evidence=ECO:0000255|HAMAP-Rule:MF_03168 141..178 4/36 (11%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.