DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dak1 and ak5

DIOPT Version :9

Sequence 1:NP_651456.1 Gene:Dak1 / 43165 FlyBaseID:FBgn0028833 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_012815974.2 Gene:ak5 / 100127649 XenbaseID:XB-GENE-5764752 Length:560 Species:Xenopus tropicalis


Alignment Length:213 Identity:63/213 - (29%)
Similarity:110/213 - (51%) Gaps:34/213 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 PHNIGIMSVEKPKIVFVLGGPGAGKGTQCSRIVDRFQFTHLSAGDLLREE-RSREGSEFGNLIED 115
            ||         |||:.|:||||:|||||..:|.:|:.|.::|.|:|||:: .|...:...:||..
 Frog   130 PH---------PKIILVIGGPGSGKGTQSLKIAERYGFEYISVGELLRKKIHSTSSNRKWSLIAK 185

  Fly   116 YIRNGKIVPVEVTCS-LLENAMKASGKSRFLIDGFPRNQDNLDGWNRQMSEKVDFQ-------FV 172
            .|..|::.|.|.|.: :.:..|:.......:||||||:          :::.:.|:       .|
 Frog   186 IITTGELAPQETTITEIKQKLMQIPDSEGIVIDGFPRD----------VAQALSFEDQICTPDLV 240

  Fly   173 LFFDCGEDVCVKRCLGRGQSGSGRTDDNLDSLKKRISTYNNDSLPIIKFFEGAGQVKRIDASPDA 237
            :|..|......:|...|.:. .||.||||.::::|:..:..:::|::.:|:..|.:...||..:.
 Frog   241 VFLACASHKLKERLQKRAEQ-QGRPDDNLKAIQRRLMNFKQNAVPLVNYFQEKGLIITFDADREE 304

  Fly   238 EEVFGEV-----EKIFVA 250
            ||||.::     .|:|.|
 Frog   305 EEVFCDISAAVDNKLFPA 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dak1NP_651456.1 UMP_CMP_kin_fam 65..249 CDD:273576 57/197 (29%)
ADK 65..240 CDD:238713 53/183 (29%)
ak5XP_012815974.2 ADK 134..307 CDD:238713 53/183 (29%)
aden_kin_iso1 372..559 CDD:130427
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1378291at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.