DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps2 and DID2

DIOPT Version :9

Sequence 1:NP_651455.1 Gene:Vps2 / 43164 FlyBaseID:FBgn0039402 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_012961.3 Gene:DID2 / 853906 SGDID:S000006435 Length:204 Species:Saccharomyces cerevisiae


Alignment Length:165 Identity:46/165 - (27%)
Similarity:87/165 - (52%) Gaps:15/165 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RDLDRERMKMEQQEKKIIADIKKMAKEGQMDAVKIMAKDLVRTRRYAKKFMLMKANIQAVSLKIQ 91
            :.|.::..|..::||:....:|:...|.: |..:|.|.:.:|.:....:.:.:.:.:.:|:.::|
Yeast    21 KQLQKQANKASKEEKQETNKLKRALNENE-DISRIYASNAIRKKNERLQLLKLASRVDSVASRVQ 84

  Fly    92 TLKSQN----TMAQAMKGVTKAMQNMNRQLNLPQIQKILQDFEKQSEMMDMKEEMIND--AIDDA 150
            |..:..    :|.|..||:.||:|||    ||.||..|:..||:|.|.:|....:..|  ...||
Yeast    85 TAVTMRQVSASMGQVCKGMDKALQNM----NLQQITMIMDKFEQQFEDLDTSVNVYEDMGVNSDA 145

  Fly   151 MEDEGDEEETDAVVSQVLDELGLQLGE--QLGDLP 183
            |  ..|.::.|.::|:|.||.|::|.:  :|.::|
Yeast   146 M--LVDNDKVDELMSKVADENGMELKQSAKLDNVP 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps2NP_651455.1 Snf7 17..185 CDD:281366 46/165 (28%)
DID2NP_012961.3 Did4 21..204 CDD:227778 46/165 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.