DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps2 and VPS24

DIOPT Version :9

Sequence 1:NP_651455.1 Gene:Vps2 / 43164 FlyBaseID:FBgn0039402 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_012883.1 Gene:VPS24 / 853825 SGDID:S000001524 Length:224 Species:Saccharomyces cerevisiae


Alignment Length:188 Identity:51/188 - (27%)
Similarity:90/188 - (47%) Gaps:29/188 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDWLFGKKISPD---------EMLRKNQRALNKAMRDLDRERMKMEQQEKKIIADIKKMAKEGQM 56
            ||::......||         .:||||.|.:.|::|:|...:.|.:|.       |||.||:..:
Yeast     1 MDYIKKAIWGPDPKEQQRRIRSVLRKNGRNIEKSLRELTVLQNKTQQL-------IKKSAKKNDV 58

  Fly    57 DAVKIMAKDLVRTRRYAKKFMLMKANIQAVSLKIQTLKSQNTMAQAMKGVTKAMQNMNRQLNLPQ 121
            ..|::.||:|.:..:...:....:|.:.:|.:||......||::..|......|:.:|..:.|||
Yeast    59 RTVRLYAKELYQINKQYDRMYTSRAQLDSVRMKIDEAIRMNTLSNQMADSAGLMREVNSLVRLPQ 123

  Fly   122 IQKILQDFEKQSEMMDMKEEMINDAIDDAMEDEGD---------EEETDAVVSQVLDE 170
            ::..:.:.||:.    ||..:|::.:||.||..||         :||.:.:|.|..:|
Yeast   124 LRNTMIELEKEL----MKSGIISEMVDDTMESVGDVGEEMDEAVDEEVNKIVEQYTNE 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps2NP_651455.1 Snf7 17..185 CDD:281366 45/163 (28%)
VPS24NP_012883.1 Did4 26..224 CDD:227778 45/163 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53529
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.