DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps2 and chmp3

DIOPT Version :9

Sequence 1:NP_651455.1 Gene:Vps2 / 43164 FlyBaseID:FBgn0039402 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_998485.1 Gene:chmp3 / 406621 ZFINID:ZDB-GENE-040426-2600 Length:221 Species:Danio rerio


Alignment Length:198 Identity:59/198 - (29%)
Similarity:107/198 - (54%) Gaps:7/198 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LFGK--KISPDEMLRKNQRALNKAMRDLDRERMKMEQQEKKIIADIKKMAKEGQMDAVKIMAKDL 66
            ||||  :..|.:::.:....:.|.||.:||:...::::|:|:...||..||:||.|...|:||::
Zfish     3 LFGKTQEKPPKDLINEWSLKIRKEMRVIDRQIRDIQREEEKVKRSIKDAAKKGQKDVCIILAKEM 67

  Fly    67 VRTRRYAKKFMLMKANIQAVSLKIQTLKSQNTMAQAMKGVTKAMQNMNRQLNLPQIQKILQDFEK 131
            ::::|...|....||.:.:|.|.::...|...:|.|::..|:.|:.|...:.:|:||..::|..|
Zfish    68 IQSKRAINKLYASKAQMNSVLLSMKNQLSVLRVAGALQKSTEVMKAMQSLVKIPEIQATMRDLSK 132

  Fly   132 QSEMMDMKEEMINDAIDDAMEDEGDEEETDAVVSQVLDELGLQLGEQLGDLPSASGSL--SIAGG 194
            :.....:.|||:.|.::...::|..||..:|.|.::|.|:   ....||..||....|  .:|.|
Zfish   133 EMMKAGIIEEMLEDTLEGMDDEEEMEEAAEAEVDKILFEI---TAGALGKAPSKVTDLPDPVAIG 194

  Fly   195 AGA 197
            |.|
Zfish   195 ATA 197

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Vps2NP_651455.1 Snf7 17..185 CDD:281366 48/167 (29%)
chmp3NP_998485.1 Snf7 18..186 CDD:281366 49/170 (29%)
Important for autoinhibitory function. /evidence=ECO:0000250 59..64 1/4 (25%)