DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps2 and Chmp1

DIOPT Version :9

Sequence 1:NP_651455.1 Gene:Vps2 / 43164 FlyBaseID:FBgn0039402 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001287108.1 Gene:Chmp1 / 40036 FlyBaseID:FBgn0036805 Length:203 Species:Drosophila melanogaster


Alignment Length:241 Identity:61/241 - (25%)
Similarity:111/241 - (46%) Gaps:45/241 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LRKNQRALNKAMRDLDRERMKMEQQEKKIIADIKKMAKEGQMDAVKIMAKDLVRTRRYAKKFMLM 79
            :.|:...|..|:::|:|...|.|::||...|..||..::|.||..:|.|::.:|.:..|..::.|
  Fly     6 MEKHLFNLKFAVKELERNSKKCEKEEKLEKAKAKKAIQKGNMDVARIHAENAIRQKNQAVNYLRM 70

  Fly    80 KANIQAVSLKIQTLKSQNTMAQAMKGVTKAMQNMNRQLNLPQIQKILQDFEKQSEMMDMKEEMIN 144
            .|.:.||:.::|:..:...:..:|.||.|||....:.:||.:|..:::.||.|.|.:|::..::.
  Fly    71 SARVDAVASRVQSALTTRKVTGSMAGVVKAMDAAMKGMNLEKISSLMEKFESQFEDLDVQSSVME 135

  Fly   145 DAIDDAMEDEGDEEETDAVVSQVLDELGLQLGEQLGDLPSASGSLSIAGGAGAQKAQAVAAGGVG 209
            ..:.|.:.....:.:.|.::.||.||.||:|..   :|||...|.|:                  
  Fly   136 GTMSDTVTTSVPQGDVDNLLQQVADEAGLELNM---ELPSGVQSQSV------------------ 179

  Fly   210 GGGAAGGGGASGGGAGGPGAPGGSGASSPMSDADADLQARLDKLRK 255
                                    |||:.:|....:|..||.:||:
  Fly   180 ------------------------GASTAVSQEQDELTQRLARLRQ 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps2NP_651455.1 Snf7 17..185 CDD:281366 49/167 (29%)
Chmp1NP_001287108.1 Snf7 42..>167 CDD:419749 34/124 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438215
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5491
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10476
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.