DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps2 and Chmp1a

DIOPT Version :9

Sequence 1:NP_651455.1 Gene:Vps2 / 43164 FlyBaseID:FBgn0039402 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001076782.1 Gene:Chmp1a / 365024 RGDID:1311083 Length:196 Species:Rattus norvegicus


Alignment Length:168 Identity:41/168 - (24%)
Similarity:91/168 - (54%) Gaps:3/168 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RDLDRERMKMEQQEKKIIADIKKMAKEGQMDAVKIMAKDLVRTRRYAKKFMLMKANIQAVSLKIQ 91
            :.|::...|.|:..|...|.:||..::..::..::.|::.:|.:.....::.|.:.:.||:.|:|
  Rat    13 KQLEKLAKKAEKDSKAEQAKVKKALQQKNVECARVYAENAIRKKNEGVNWLRMASRVDAVASKVQ 77

  Fly    92 TLKSQNTMAQAMKGVTKAMQNMNRQLNLPQIQKILQDFEKQSEMMDMKEEMINDAIDDAMEDEGD 156
            |..:...:.:.|..||||:......::|.::..::..||:|.:.:|:...::.|::..|......
  Rat    78 TAVTMKGVTKNMAQVTKALDKALSAMDLQKVSAVMDRFEQQVQNLDVHTSVMEDSVSSATTLTTP 142

  Fly   157 EEETDAVVSQVLDELGLQLGEQLGDLP---SASGSLSI 191
            :|:.|:::.|:.:|.||::.:||..||   ||.|..|:
  Rat   143 QEQVDSLIVQIAEENGLEVLDQLSQLPEGASAVGESSV 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps2NP_651455.1 Snf7 17..185 CDD:281366 37/160 (23%)
Chmp1aNP_001076782.1 Snf7 12..195 CDD:419749 41/168 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.