DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps2 and Chmp2b

DIOPT Version :9

Sequence 1:NP_651455.1 Gene:Vps2 / 43164 FlyBaseID:FBgn0039402 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_343996.5 Gene:Chmp2b / 363720 RGDID:1306781 Length:213 Species:Rattus norvegicus


Alignment Length:194 Identity:69/194 - (35%)
Similarity:122/194 - (62%) Gaps:1/194 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LFGKKISPDEMLRKNQRALNKAMRDLDRERMKMEQQEKKIIADIKKMAKEGQMDAVKIMAKDLVR 68
            ||.|| :.|:::::..|.|....|.:.|:|..:|:|||::..:||||||.|..:|.:::||.||.
  Rat     4 LFKKK-TVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACRVLAKQLVH 67

  Fly    69 TRRYAKKFMLMKANIQAVSLKIQTLKSQNTMAQAMKGVTKAMQNMNRQLNLPQIQKILQDFEKQS 133
            .|:...:...:.:.:.::|.:.:.:.||..||.||....|.||.:|::::..:..:.:|:|:|::
  Rat    68 LRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKEN 132

  Fly   134 EMMDMKEEMINDAIDDAMEDEGDEEETDAVVSQVLDELGLQLGEQLGDLPSASGSLSIAGGAGA 197
            ..|:|.||||||.:||..:...||||:..:|:|||||:|:::..::...|||:.||..|..:.|
  Rat   133 MKMEMTEEMINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSASTSKA 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps2NP_651455.1 Snf7 17..185 CDD:281366 58/167 (35%)
Chmp2bXP_343996.5 Snf7 16..185 CDD:397437 59/168 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53529
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.