DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps2 and RGD1566265

DIOPT Version :9

Sequence 1:NP_651455.1 Gene:Vps2 / 43164 FlyBaseID:FBgn0039402 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001128061.1 Gene:RGD1566265 / 363487 RGDID:1566265 Length:199 Species:Rattus norvegicus


Alignment Length:190 Identity:51/190 - (26%)
Similarity:99/190 - (52%) Gaps:0/190 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LRKNQRALNKAMRDLDRERMKMEQQEKKIIADIKKMAKEGQMDAVKIMAKDLVRTRRYAKKFMLM 79
            :.|:...|..|.::|:|...|.:::||...|.|||..::|..:..:|.|::.:|.:..|..|:.|
  Rat     4 MEKHLFNLKFAAKELNRNAKKCDKEEKAEKAKIKKAIQKGNTEVARIHAENAIRQKNQAINFLRM 68

  Fly    80 KANIQAVSLKIQTLKSQNTMAQAMKGVTKAMQNMNRQLNLPQIQKILQDFEKQSEMMDMKEEMIN 144
            .|.:.||:.::||..:...:.::|.||.|:|....|.:||.:|..::..||.|.|.:|::.:.:.
  Rat    69 SARVDAVAARVQTAVTMGKVTKSMAGVVKSMDATLRSMNLEKISALMDKFEHQFETLDVQTQQME 133

  Fly   145 DAIDDAMEDEGDEEETDAVVSQVLDELGLQLGEQLGDLPSASGSLSIAGGAGAQKAQAVA 204
            |.:.........:.:.|.::.::.||.||.|..:|....:.|...|:|.....:.:|.:|
  Rat   134 DTMSSTTTLTTPQNQVDMLLQEMADEAGLDLNMELPQGQTGSVGASVASTEQDELSQRLA 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps2NP_651455.1 Snf7 17..185 CDD:281366 46/167 (28%)
RGD1566265NP_001128061.1 Snf7 49..>165 CDD:419749 31/115 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.