DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Exo84 and AT1G10180

DIOPT Version :9

Sequence 1:NP_996299.1 Gene:Exo84 / 43163 FlyBaseID:FBgn0266668 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_563863.1 Gene:AT1G10180 / 837556 AraportID:AT1G10180 Length:769 Species:Arabidopsis thaliana


Alignment Length:483 Identity:95/483 - (19%)
Similarity:167/483 - (34%) Gaps:147/483 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 INIITPDG--SKIYQSITAAG----------------------KTEWIEKL---EEAFRFDQQKK 242
            |..|||..  ..::||:|..|                      :|:::..|   |||...:.:..
plant    13 IESITPQSKIDSVHQSLTEKGIRKLCCELMDLKDAVENMCGDMRTKYLAFLRISEEAVEMEHELV 77

  Fly   243 PKKGQAPQPPTRAKQQSKASTPEKETTPQSPGQ-----------PKSLEDETPEWLSTASEEIQT 296
            ..:..........:........|.:...:.||.           |..:.|...|:|    |:|..
plant    78 ELRKHISSQGILVQDLMAGVCREMDDWNRLPGDVHDAEVEEDPLPNEVTDPKSEFL----EKIDL 138

  Fly   297 LVAQRHFEDAQELIKRTQDFLRNENRKKLPLADAIE-TKVKQQELKLINVLLKELSNSHNRNLQI 360
            |:|:...::|.|.:..       |.|....|..::| :..|...::...||..:|          
plant   139 LLAEHKVDEALEAMDA-------EERSSPDLKGSVEMSSYKSAFMERKAVLEDQL---------- 186

  Fly   361 ALRAAKRP----------LKILVEMGRYRQASATLLKVCAVSLRVAQREARRNN----------- 404
             ||.||:|          |..|:.:|:...|...|||..|.|||      ||..           
plant   187 -LRIAKQPSICVAELKHALIGLIRLGKGPSAHQLLLKFYATSLR------RRIEAFLPSCLTCPN 244

  Fly   405 ---ADISELFFCDLTQVACDFLTAF--EKQPACVSALVVWCNAELQYFASQLIKHYLT---KGTS 461
               |.:|:|.|.:::....:....|  :..||..:.:|.|...|::|.. :|:|...:   ..::
plant   245 TFPATLSKLVFSNISVATKESAAMFGDDDNPAYSNKVVQWAEREVEYLV-RLVKENASPSETASA 308

  Fly   462 LESVAKCVERVRKPSTKLTEIGLDISYHLEGLLRTTLESLIE---ESKERLLDSVGRTEESWQPY 523
            |.:.:.|::........|...||.:|.....|.|..:|.::|   ....|::..:..|:|     
plant   309 LRAASICLQDCLNYCKVLEPQGLFLSKLFLVLFRPYVEEVLELNFRRARRVIFDLNETDE----- 368

  Fly   524 NLQTKSNLKRLLLELDVLGIDVRAQATGDTWIN-------------LTQSTVVFIRHF------- 568
            .|::.|:...:|.|..:         ..||.:.             |.|.|.:.:.||       
plant   369 GLESPSDFVTILSEFAI---------ASDTMMTDCSIRFMQIVQDILEQLTHLVVLHFGESVLTR 424

  Fly   569 -LQLTEYCGCLAKCETLLQSLELLLKEL 595
             |||.:            :.::.|:|.|
plant   425 ILQLYD------------KYIDFLIKAL 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Exo84NP_996299.1 Vps51 4..90 CDD:285862
PH_RalBD_exo84 132..242 CDD:269933 13/63 (21%)
PH 142..234 CDD:278594 11/55 (20%)
RCSD 225..293 CDD:282963 12/81 (15%)
Exo84_C 285..485 CDD:293136 51/229 (22%)
AT1G10180NP_563863.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21426
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.