| Sequence 1: | NP_996298.1 | Gene: | gro / 43162 | FlyBaseID: | FBgn0001139 | Length: | 730 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_004688.2 | Gene: | PRPF4 / 9128 | HGNCID: | 17349 | Length: | 522 | Species: | Homo sapiens |
| Alignment Length: | 236 | Identity: | 65/236 - (27%) |
|---|---|---|---|
| Similarity: | 101/236 - (42%) | Gaps: | 16/236 - (6%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 495 SVKLLPDGRTLIVGGEASNLSIWDLAS--PTPRIKAELTSAAPACYALAISPDSKVCFSCCSDGN 557
Fly 558 IAVWDLHNEILVRQFQGHTDGASCIDISPDGSRLWTGGLDNTVRSWDLREGR---QLQQHDFSSQ 619
Fly 620 IFSLGYCPTGDWLAVGMENSHVEVLH-ASKPDKYQLHLHESCVLSLRFAACGKWFVSTGK-DNLL 682
Fly 683 NAWRTPYGASIFQ--SKETSSVLSCDISTDDKYIVTGSGDK 721 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| gro | NP_996298.1 | TLE_N | 11..124 | CDD:397828 | |
| WD40 | 442..727 | CDD:238121 | 65/236 (28%) | ||
| WD40 repeat | 447..486 | CDD:293791 | |||
| WD40 repeat | 494..532 | CDD:293791 | 9/38 (24%) | ||
| WD40 repeat | 537..573 | CDD:293791 | 6/35 (17%) | ||
| WD40 repeat | 580..615 | CDD:293791 | 17/37 (46%) | ||
| WD40 repeat | 620..653 | CDD:293791 | 6/33 (18%) | ||
| WD40 repeat | 661..695 | CDD:293791 | 11/34 (32%) | ||
| WD40 repeat | 702..726 | CDD:293791 | 9/20 (45%) | ||
| PRPF4 | NP_004688.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..20 | ||
| SFM | 103..141 | CDD:128776 | |||
| WD 1 | 229..268 | ||||
| WD40 | 233..519 | CDD:238121 | 65/236 (28%) | ||
| WD40 repeat | 234..271 | CDD:293791 | |||
| WD 2 | 271..318 | 8/31 (26%) | |||
| WD40 repeat | 285..321 | CDD:293791 | 9/34 (26%) | ||
| WD 3 | 321..360 | 7/42 (17%) | |||
| WD40 repeat | 326..362 | CDD:293791 | 7/39 (18%) | ||
| WD 4 | 363..402 | 19/38 (50%) | |||
| WD40 repeat | 369..404 | CDD:293791 | 16/34 (47%) | ||
| WD 5 | 405..444 | 7/40 (18%) | |||
| WD40 repeat | 410..444 | CDD:293791 | 6/33 (18%) | ||
| WD 6 | 447..487 | 12/40 (30%) | |||
| WD40 repeat | 452..489 | CDD:293791 | 11/37 (30%) | ||
| WD 7 | 490..521 | 9/25 (36%) | |||
| WD40 repeat | 495..519 | CDD:293791 | 9/20 (45%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||