DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gro and PFS2

DIOPT Version :9

Sequence 1:NP_996298.1 Gene:gro / 43162 FlyBaseID:FBgn0001139 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_014082.1 Gene:PFS2 / 855399 SGDID:S000005261 Length:465 Species:Saccharomyces cerevisiae


Alignment Length:397 Identity:77/397 - (19%)
Similarity:129/397 - (32%) Gaps:149/397 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   381 PYDPHAHVRTNGIPHPSALTGGKPAYSFHMNGEGSLQPVPFPPDALVGVGIPRHARQINTLSHGE 445
            ||....:.|.:|:  |:.:...:.:|:..:          .||:|..|     ..|.||.     
Yeast    38 PYINLYYNRRHGL--PNLVVEPETSYTIDI----------MPPNAYRG-----RDRVINL----- 80

  Fly   446 VVCAVTISNPTKYVYTGGKGCVKVWDISQPGNKNPVSQLDCLQRDNYIRSVKLLPDGRTLIVGGE 510
                     |:|:.:.               :.|.|..:        |.:::..|:||.|:|...
Yeast    81 ---------PSKFTHL---------------SSNKVKHV--------IPAIQWTPEGRRLVVATY 113

  Fly   511 ASNLSIWDLASPTPRIKAELTSAA-----------------------------------PACYAL 540
            :...|:|:.:|.|.....:...:|                                   .|.:..
Yeast   114 SGEFSLWNASSFTFETLMQAHDSAVTTMKYSHDSDWMISGDADGMIKIWQPNFSMVKEIDAAHTE 178

  Fly   541 AI------SPDSKVCFSCCSDGNI-AVWDLHNEILVRQFQG-HTDGASCIDISPDGSRLWTGGLD 597
            :|      |.|||  |..|||.|| .:|:..|....|...| |.|..|| |..|:...:.:...|
Yeast   179 SIRDMAFSSNDSK--FVTCSDDNILKIWNFSNGKQERVLSGHHWDVKSC-DWHPEMGLIASASKD 240

  Fly   598 NTVRSWDLREGRQLQ-----QH--------------------DFSSQIFSLGY------C----- 626
            |.|:.||.|.|..:.     :|                    |.|.::|.:.|      |     
Yeast   241 NLVKLWDPRSGNCISSILKFKHTVLKTRFQPTKGNLLMAISKDKSCRVFDIRYSMKELMCVRDET 305

  Fly   627 --PTGDWLAVGMEN----------SHVEVL-HASKPDKYQLHLHESCVLSLRFAACGKWFVSTGK 678
              .|.:|..:....          .|.::| :.::|.....:.|:.|:.||.:...|..|.:..|
Yeast   306 DYMTLEWHPINESMFTLACYDGSLKHFDLLQNLNEPILTIPYAHDKCITSLSYNPVGHIFATAAK 370

  Fly   679 DNLLNAW 685
            |..:..|
Yeast   371 DRTIRFW 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
groNP_996298.1 TLE_N 11..124 CDD:397828
WD40 442..727 CDD:238121 64/336 (19%)
WD40 repeat 447..486 CDD:293791 4/38 (11%)
WD40 repeat 494..532 CDD:293791 9/37 (24%)
WD40 repeat 537..573 CDD:293791 14/42 (33%)
WD40 repeat 580..615 CDD:293791 12/59 (20%)
WD40 repeat 620..653 CDD:293791 8/56 (14%)
WD40 repeat 661..695 CDD:293791 7/25 (28%)
WD40 repeat 702..726 CDD:293791
PFS2NP_014082.1 WD40 93..377 CDD:238121 59/294 (20%)
WD40 repeat 98..133 CDD:293791 9/34 (26%)
WD40 repeat 139..175 CDD:293791 0/35 (0%)
WD40 repeat 180..216 CDD:293791 14/37 (38%)
WD40 repeat 223..257 CDD:293791 11/34 (32%)
WD40 repeat 264..299 CDD:293791 4/34 (12%)
WD40 repeat 307..346 CDD:293791 5/38 (13%)
WD40 repeat 353..377 CDD:293791 6/23 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.