Sequence 1: | NP_996298.1 | Gene: | gro / 43162 | FlyBaseID: | FBgn0001139 | Length: | 730 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_014082.1 | Gene: | PFS2 / 855399 | SGDID: | S000005261 | Length: | 465 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 397 | Identity: | 77/397 - (19%) |
---|---|---|---|
Similarity: | 129/397 - (32%) | Gaps: | 149/397 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 381 PYDPHAHVRTNGIPHPSALTGGKPAYSFHMNGEGSLQPVPFPPDALVGVGIPRHARQINTLSHGE 445
Fly 446 VVCAVTISNPTKYVYTGGKGCVKVWDISQPGNKNPVSQLDCLQRDNYIRSVKLLPDGRTLIVGGE 510
Fly 511 ASNLSIWDLASPTPRIKAELTSAA-----------------------------------PACYAL 540
Fly 541 AI------SPDSKVCFSCCSDGNI-AVWDLHNEILVRQFQG-HTDGASCIDISPDGSRLWTGGLD 597
Fly 598 NTVRSWDLREGRQLQ-----QH--------------------DFSSQIFSLGY------C----- 626
Fly 627 --PTGDWLAVGMEN----------SHVEVL-HASKPDKYQLHLHESCVLSLRFAACGKWFVSTGK 678
Fly 679 DNLLNAW 685 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
gro | NP_996298.1 | TLE_N | 11..124 | CDD:397828 | |
WD40 | 442..727 | CDD:238121 | 64/336 (19%) | ||
WD40 repeat | 447..486 | CDD:293791 | 4/38 (11%) | ||
WD40 repeat | 494..532 | CDD:293791 | 9/37 (24%) | ||
WD40 repeat | 537..573 | CDD:293791 | 14/42 (33%) | ||
WD40 repeat | 580..615 | CDD:293791 | 12/59 (20%) | ||
WD40 repeat | 620..653 | CDD:293791 | 8/56 (14%) | ||
WD40 repeat | 661..695 | CDD:293791 | 7/25 (28%) | ||
WD40 repeat | 702..726 | CDD:293791 | |||
PFS2 | NP_014082.1 | WD40 | 93..377 | CDD:238121 | 59/294 (20%) |
WD40 repeat | 98..133 | CDD:293791 | 9/34 (26%) | ||
WD40 repeat | 139..175 | CDD:293791 | 0/35 (0%) | ||
WD40 repeat | 180..216 | CDD:293791 | 14/37 (38%) | ||
WD40 repeat | 223..257 | CDD:293791 | 11/34 (32%) | ||
WD40 repeat | 264..299 | CDD:293791 | 4/34 (12%) | ||
WD40 repeat | 307..346 | CDD:293791 | 5/38 (13%) | ||
WD40 repeat | 353..377 | CDD:293791 | 6/23 (26%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |