DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gro and NSA1

DIOPT Version :9

Sequence 1:NP_996298.1 Gene:gro / 43162 FlyBaseID:FBgn0001139 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_011404.1 Gene:NSA1 / 852767 SGDID:S000003079 Length:463 Species:Saccharomyces cerevisiae


Alignment Length:173 Identity:39/173 - (22%)
Similarity:65/173 - (37%) Gaps:50/173 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   453 SNPTKYVYTGGKGCVKVWDISQPGNKNPVSQLDCLQRDNYIRSVKLLPDGRTLIVGGEASNLSIW 517
            |:.|||             .:|.|.| |.:|:|            |||:...|      |.:.::
Yeast   277 SHLTKY-------------STQHGRK-PFAQID------------LLPNREPL------SQMEVF 309

  Fly   518 D-----LASPTPRIKAELTSAAPACYALAISPDSKVCFSCCSDGNIAVWDLHNEILVRQFQGHTD 577
            |     :.|.....::|..:...     .|:.|.|        .|:..:|.:..:|.:..:....
Yeast   310 DAKGENVVSSLGNFQSETFNELN-----VITTDYK--------KNVFKFDGNGRMLGKVGRDDIT 361

  Fly   578 GASCIDISPDGSRLWTGGLDNTVRSWDLREGRQLQQHDFSSQI 620
            |:|......||..|..||||..||.:|::..:.|.:....|:|
Yeast   362 GSSTYIHVHDGKYLLQGGLDRYVRIFDIKTNKMLVKVYVGSRI 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
groNP_996298.1 TLE_N 11..124 CDD:397828
WD40 442..727 CDD:238121 39/173 (23%)
WD40 repeat 447..486 CDD:293791 9/32 (28%)
WD40 repeat 494..532 CDD:293791 8/42 (19%)
WD40 repeat 537..573 CDD:293791 6/35 (17%)
WD40 repeat 580..615 CDD:293791 12/34 (35%)
WD40 repeat 620..653 CDD:293791 1/1 (100%)
WD40 repeat 661..695 CDD:293791
WD40 repeat 702..726 CDD:293791
NSA1NP_011404.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.