DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gro and AT5G50550

DIOPT Version :9

Sequence 1:NP_996298.1 Gene:gro / 43162 FlyBaseID:FBgn0001139 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_568738.1 Gene:AT5G50550 / 835123 AraportID:AT5G50550 Length:383 Species:Arabidopsis thaliana


Alignment Length:315 Identity:69/315 - (21%)
Similarity:116/315 - (36%) Gaps:61/315 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   391 NGIPHPSALTGGKPAYSFHMNGEGSLQPVPFPPDALVGVGIPR----HARQINTLSHGEVVCAVT 451
            :|||:...:.    ....|.|.. |.||:   ...::|..:|.    |.||      |.::||: 
plant    62 SGIPNVILIC----RVDLHTNSL-SEQPI---GRRVIGTDLPYRMAIHPRQ------GGLICAL- 111

  Fly   452 ISNPTKYVYTGGKGCVKVWDISQPGNKNPVSQL-DCLQRDNYIRSVKLLPDGRTLIVGGEASNLS 515
               |........:..::  |.::..::..|.:| |..|:    .|:....||..|..|.|...|.
plant   112 ---PNSCRLFDWENIIE--DDNEEESEKVVKELKDVGQQ----LSLSFNQDGTVLATGAEDGTLR 167

  Fly   516 IWDLASPTPRIKAELTSAAPACYALAISPDSKVCFS----CCSDGNIAVWDLHNEILVRQFQGHT 576
            :::..|....:....|.|  :..:|..|...|...|    .|     .|||::....:.......
plant   168 VFEWPSMKTLLNESKTHA--SVKSLTFSESGKFLVSLGAPLC-----RVWDVNASAAIASLSKEK 225

  Fly   577 DG--ASC-IDISPDGSR-LWTGGLDNTVR----------SWDLREGRQLQQHDFSSQIFSLGYCP 627
            |.  ||| ..:...||. |:...  ||.|          ||..|..:.:::   ::.|.:.....
plant   226 DEMFASCRFSVDNSGSEVLYVAA--NTQRGGSIITWDTTSWRRRSSKLIKR---NNSISAFNVSA 285

  Fly   628 TGDWLAVGMENSHVEVLHASKPDKYQL--HLHESCVLSLRFAACGKWFVSTGKDN 680
            .|..||||.....|.::.::|....|:  ..|...|.:|.|:...:..||...|:
plant   286 DGKLLAVGTLEGDVLIIDSTKMQTNQIVKKAHLGLVTALTFSPDSRCLVSVSFDS 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
groNP_996298.1 TLE_N 11..124 CDD:397828
WD40 442..727 CDD:238121 56/260 (22%)
WD40 repeat 447..486 CDD:293791 6/39 (15%)
WD40 repeat 494..532 CDD:293791 8/37 (22%)
WD40 repeat 537..573 CDD:293791 8/39 (21%)
WD40 repeat 580..615 CDD:293791 11/46 (24%)
WD40 repeat 620..653 CDD:293791 8/32 (25%)
WD40 repeat 661..695 CDD:293791 6/20 (30%)
WD40 repeat 702..726 CDD:293791
AT5G50550NP_568738.1 WD40 68..>344 CDD:225201 66/309 (21%)
WD40 <107..344 CDD:295369 55/256 (21%)
WD40 repeat 147..182 CDD:293791 8/34 (24%)
WD40 repeat 188..224 CDD:293791 8/40 (20%)
WD40 repeat 229..271 CDD:293791 12/43 (28%)
WD40 repeat 279..314 CDD:293791 8/34 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.