DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gro and SPA2

DIOPT Version :9

Sequence 1:NP_996298.1 Gene:gro / 43162 FlyBaseID:FBgn0001139 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_192849.4 Gene:SPA2 / 826712 AraportID:AT4G11110 Length:1036 Species:Arabidopsis thaliana


Alignment Length:714 Identity:138/714 - (19%)
Similarity:225/714 - (31%) Gaps:261/714 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 EEFNFLQAQYHSIKLECEKLS-NEKTEMQRHYVMYYEMSYGLNVEMHKQTEIAKRLNTLINQLLP 96
            :||:|..:|.|...:.|...| :|:.|.:     :|.....|..:|...:.....|..|:.:||.
plant   433 QEFHFRSSQPHCSTVACPFTSVSEQLEEK-----WYASPEELRGDMRSASSNIYSLGILLYELLS 492

  Fly    97 FLQADHQQQVLQAVERAKQVTMQELNLIIGHQQQHGIQQLLQQIHAQQVPGGPPQPMGALNPFGA 161
            ..|.          |||::..|.::        :|.|.              ||:.:.. ||..|
plant   493 QFQC----------ERAREAAMSDI--------RHRIL--------------PPKFLSE-NPKEA 524

  Fly   162 LGATMGLPHGPQGLLNKPPEHHRPDIKPTGLEGPAAAEERLRNSVSPADREKYRTRSPLDIENDS 226
             |..:.|.|        |....||           :..:.|::.|.....:.|.....|.||   
plant   525 -GFCLWLLH--------PESSCRP-----------STRDILQSEVVNGIPDLYAEGLSLSIE--- 566

  Fly   227 KRRKDEKLQEDEGEKSDQDLVVDVANEMESHSPRPNGEHVSMEVRDRESLNGERLEKPSSSGIKQ 291
                    |||...:..|..:.....:.:.|:.....|..|:|. |.|    |.:::..:.|   
plant   567 --------QEDTESELLQHFLFLSQEKRQKHAGNLMEEIASVEA-DIE----EIVKRRCAIG--- 615

  Fly   292 ERPPSRSGSSSSRSTPSLKTKDMEKPGTPGAKARTPTPNAAAPAPGV--NPKQMMPQGPPPAGYP 354
              |||...:|||                        :|.::.|...:  |..|:           
plant   616 --PPSLEEASSS------------------------SPASSVPEMRLIRNINQL----------- 643

  Fly   355 GAPYQRPADPYQRPPSDPAYGRPPPMPYDPHAHVRTNGIPHPSALTGGKPAYSFHMNGEGSLQPV 419
                            :.||.......:.|.|..|.            :|......|.:.::..|
plant   644 ----------------ESAYFAARIDAHLPEARYRL------------RPDRDLLRNSDNTVAEV 680

  Fly   420 ----PFPPDALVGV---GIPRHAR-------------QINTLSHGEVVCAVTISNPTKYVYTGG- 463
                .:..|..||.   |:.::||             ::|..|:  |:|::.......|..|.| 
plant   681 ENSETWSSDDRVGAFFDGLCKYARYSKFETRGVLRTSELNNTSN--VICSLGFDRDEDYFATAGV 743

  Fly   464 KGCVKVW----------DISQPGNKNP-VSQLDCLQRDNYIRS----------VKLLPDGRTLIV 507
            ...:|::          ||..|..:.| .|:|..:..:||||:          |||..     :.
plant   744 SKKIKIYEFNSLFNESVDIHYPAIEMPNRSKLSGVCWNNYIRNYLASSDYDGIVKLWD-----VT 803

  Fly   508 GGEASNLSI------WDL----ASPTPRIKAELTSAAPACYALAISPDSKVCFS--------CC- 553
            .|:|.:..|      |.:    |.||     :|.|.:..|.....:.:.:.|..        || 
plant   804 TGQAISHFIEHEKRAWSVDFSEACPT-----KLASGSDDCSVKLWNINERNCLGTIRNIANVCCV 863

  Fly   554 --------------SDGNIAVWDLHNEILVRQ----FQGHTDGASCIDISPDGSRLWTGGLDNTV 600
                          ||.....:||.|   :|.    ..||....|..... |...|.|...|||:
plant   864 QFSPQSSHLLAFGSSDFRTYCYDLRN---LRTPWCILSGHNKAVSYAKFL-DNETLVTASTDNTL 924

  Fly   601 RSWDLRE---------------GRQLQQHDFSSQIFSLGYCPTGDWLAVGMENSHVEVLHASKP 649
            :.|||::               |....:.:|      :|...:..::|.|.|.:.|...|.|.|
plant   925 KLWDLKKTTHGGLSTNACSLTFGGHTNEKNF------VGLSTSDGYIACGSETNEVYAYHRSLP 982

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
groNP_996298.1 TLE_N 11..124 CDD:397828 21/91 (23%)
WD40 442..727 CDD:238121 61/282 (22%)
WD40 repeat 447..486 CDD:293791 11/50 (22%)
WD40 repeat 494..532 CDD:293791 12/57 (21%)
WD40 repeat 537..573 CDD:293791 10/62 (16%)
WD40 repeat 580..615 CDD:293791 11/49 (22%)
WD40 repeat 620..653 CDD:293791 8/30 (27%)
WD40 repeat 661..695 CDD:293791
WD40 repeat 702..726 CDD:293791
SPA2NP_192849.4 PLN00181 299..1036 CDD:177776 138/714 (19%)
PKc_like <299..548 CDD:304357 35/172 (20%)
WD40 723..1032 CDD:238121 61/282 (22%)
WD40 repeat 726..769 CDD:293791 8/42 (19%)
WD40 repeat 776..813 CDD:293791 9/41 (22%)
WD40 repeat 818..855 CDD:293791 8/41 (20%)
WD40 repeat 861..897 CDD:293791 8/38 (21%)
WD40 repeat 904..947 CDD:293791 10/43 (23%)
WD40 repeat 954..1002 CDD:293791 9/35 (26%)
WD40 repeat 1009..1032 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.