DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gro and PHF1

DIOPT Version :9

Sequence 1:NP_996298.1 Gene:gro / 43162 FlyBaseID:FBgn0001139 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_566961.1 Gene:PHF1 / 824384 AraportID:AT3G52190 Length:398 Species:Arabidopsis thaliana


Alignment Length:331 Identity:76/331 - (22%)
Similarity:114/331 - (34%) Gaps:104/331 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   444 GEVVCAVTISNPTKYVYTGGKGCVKVWDISQPGNKNPVSQLDCLQRDNYIRSVKLLPDGRTLIVG 508
            |.|||...|..|.|.          .|.:....:|         :|.:.:.|..||         
plant    11 GHVVCGSWIRRPKKV----------NWVLIAKASK---------RRGSSVSSPALL--------- 47

  Fly   509 GEASNLSIWDLASPTPRIKAELTSAAPACYALAISPDSKVCFS--------CCS----------- 554
                |:..:|      .|.|.|:|:..|.:.|..|....|..|        .||           
plant    48 ----NIFSFD------PITASLSSSPLATHTLKDSDGDPVAVSVHPGGDYFVCSTSKGGCKLFEL 102

  Fly   555 -DGNIAVWDLHNEILVRQFQGHTDGASCIDISPDGSRLWTGGLDNTVR--SW--------DLREG 608
             .|...:..|..|:|..|..|.   ..|:..|.|||:|..||:|..:|  .|        :.:..
plant   103 VGGATGITILAKELLPLQNAGL---QKCMAFSFDGSKLAVGGVDGCLRIMEWPNLSVILDEPKAH 164

  Fly   609 RQLQQHDFSSQIFSLGYCPTGD----WLAVGMENSHVEVLHASKPDKYQLHLHESCVLSLRFAAC 669
            :.::..|||.....|....|..    |.|  .:...:..|..|..:..:|     |    ||:..
plant   165 KSIRDMDFSLDSEFLATTSTDGSARIWKA--EDGFPLSTLERSGDENIEL-----C----RFSKD 218

  Fly   670 G-KWFV----STGKDNLLNAWRTPYGASIFQ-------SKETSSVLSCDISTDDKYIVTGSGDKK 722
            | |.|:    ..|...::|.    |..|.::       |::|:|.::  :|.|.|||..|..|..
plant   219 GTKPFLFCAAQRGDTPMVNV----YDISTWKKLGFKKLSRKTASTMA--VSLDGKYIALGGKDGD 277

  Fly   723 ATVYEV 728
            .:|.||
plant   278 VSVAEV 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
groNP_996298.1 TLE_N 11..124 CDD:397828
WD40 442..727 CDD:238121 74/328 (23%)
WD40 repeat 447..486 CDD:293791 7/38 (18%)
WD40 repeat 494..532 CDD:293791 8/37 (22%)
WD40 repeat 537..573 CDD:293791 11/55 (20%)
WD40 repeat 580..615 CDD:293791 11/44 (25%)
WD40 repeat 620..653 CDD:293791 6/36 (17%)
WD40 repeat 661..695 CDD:293791 9/38 (24%)
WD40 repeat 702..726 CDD:293791 7/23 (30%)
PHF1NP_566961.1 WD40 repeat 78..119 CDD:293791 7/40 (18%)
WD40 127..>318 CDD:421866 44/174 (25%)
WD40 repeat 127..162 CDD:293791 11/34 (32%)
WD40 repeat 168..204 CDD:293791 8/37 (22%)
WD40 repeat 210..250 CDD:293791 11/52 (21%)
WD40 repeat 258..294 CDD:293791 11/28 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.