DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gro and WDR5a

DIOPT Version :9

Sequence 1:NP_996298.1 Gene:gro / 43162 FlyBaseID:FBgn0001139 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_190535.1 Gene:WDR5a / 824128 AraportID:AT3G49660 Length:317 Species:Arabidopsis thaliana


Alignment Length:287 Identity:67/287 - (23%)
Similarity:113/287 - (39%) Gaps:54/287 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   493 IRSVKLLPDGRTLIVGGEASNL---SIWDLASPTPRIKAELTSAAPACYALAISPDSKVCFSCCS 554
            :.|||...|||.|........:   :|..:..|......|.|........:|.|.|::...|...
plant    27 VSSVKFSSDGRLLASASADKTIRTYTINTINDPIAEPVQEFTGHENGISDVAFSSDARFIVSASD 91

  Fly   555 DGNIAVWDLHNEILVRQFQGHTDGASCIDISPDGSRLWTGGLDNTVRSWDLREGRQLQ---QH-- 614
            |..:.:||:....|::...|||:.|.|::.:|..:.:.:|..|.|||.||:..|:.|:   .|  
plant    92 DKTLKLWDVETGSLIKTLIGHTNYAFCVNFNPQSNMIVSGSFDETVRIWDVTTGKCLKVLPAHSD 156

  Fly   615 -----DFS---SQIFS-------------LGYC------------------PTGDWLAVGMENSH 640
                 ||:   |.|.|             .|:|                  |.|.::.||..::.
plant   157 PVTAVDFNRDGSLIVSSSYDGLCRIWDSGTGHCVKTLIDDENPPVSFVRFSPNGKFILVGTLDNT 221

  Fly   641 VEVLHASKP---DKYQLHLH-ESCVLSLRFAACGKWFVSTGKDNLLNAWRTPYGASIFQSKE--T 699
            :.:.:.|..   ..|..|:: :.|:.|......||..||..:||.::.|.. ....:.|..|  |
plant   222 LRLWNISSAKFLKTYTGHVNAQYCISSAFSVTNGKRIVSGSEDNCVHMWEL-NSKKLLQKLEGHT 285

  Fly   700 SSVLSCDISTDDKYIVTGSGDKKATVY 726
            .:|::......:..|.:||.||...::
plant   286 ETVMNVACHPTENLIASGSLDKTVRIW 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
groNP_996298.1 TLE_N 11..124 CDD:397828
WD40 442..727 CDD:238121 67/287 (23%)
WD40 repeat 447..486 CDD:293791
WD40 repeat 494..532 CDD:293791 10/40 (25%)
WD40 repeat 537..573 CDD:293791 8/35 (23%)
WD40 repeat 580..615 CDD:293791 12/44 (27%)
WD40 repeat 620..653 CDD:293791 9/66 (14%)
WD40 repeat 661..695 CDD:293791 8/33 (24%)
WD40 repeat 702..726 CDD:293791 6/23 (26%)
WDR5aNP_190535.1 WD40 16..312 CDD:238121 67/285 (24%)
WD40 repeat 27..69 CDD:293791 10/41 (24%)
WD40 repeat 75..111 CDD:293791 8/35 (23%)
WD40 repeat 116..152 CDD:293791 12/35 (34%)
WD40 repeat 159..194 CDD:293791 7/34 (21%)
WD40 repeat 201..237 CDD:293791 5/35 (14%)
WD40 repeat 245..282 CDD:293791 10/37 (27%)
WD40 repeat 288..312 CDD:293791 6/23 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.