DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gro and TBL1XR1

DIOPT Version :9

Sequence 1:NP_996298.1 Gene:gro / 43162 FlyBaseID:FBgn0001139 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_001308122.1 Gene:TBL1XR1 / 79718 HGNCID:29529 Length:514 Species:Homo sapiens


Alignment Length:367 Identity:82/367 - (22%)
Similarity:139/367 - (37%) Gaps:97/367 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   419 VPFPPDALVGVGIPRHARQINTLSHGEVVCAVTISNPTKYVYTGGKG--CVKVWDISQ------- 474
            |..||:.  .|.:..|..::       .:||   .||...:...|.|  ..::|::|:       
Human   155 VEIPPNK--AVVLRGHESEV-------FICA---WNPVSDLLASGSGDSTARIWNLSENSTSGST 207

  Fly   475 ---------------PGNKNPVSQLD------CLQRDNY-----------------------IRS 495
                           |.||: |:.||      .|...:|                       |.:
Human   208 QLVLRHCIREGGQDVPSNKD-VTSLDWNSEGTLLATGSYDGFARIWTKDGNLASTLGQHKGPIFA 271

  Fly   496 VKLLPDGRTLIVGGEASNLSIWDLASPTPRIKAELT-SAAPACYALAISPDSKVCF-SCCSDGNI 558
            :|....|..::..|......|||  :.|...|.:.. .:||   ||.:...|...| ||.:|..|
Human   272 LKWNKKGNFILSAGVDKTTIIWD--AHTGEAKQQFPFHSAP---ALDVDWQSNNTFASCSTDMCI 331

  Fly   559 AVWDLHNEILVRQFQGHTDGASCIDISPDGSRLWTGGLDNTVRSWDLREG---RQLQQHDFSSQI 620
            .|..|..:..::.|||||:..:.|...|.|:.|.:...|.|::.|.:::.   ..||.|  :.:|
Human   332 HVCKLGQDRPIKTFQGHTNEVNAIKWDPTGNLLASCSDDMTLKIWSMKQDNCVHDLQAH--NKEI 394

  Fly   621 FSLGYCPTGDWLAVGMENSHVEVLHASKP----------DK----YQLHLHESCVLSLRFAACGK 671
            :::.:.|||.    |..|.:..::.||..          |:    :.|..|:..|.|:.|:..|:
Human   395 YTIKWSPTGP----GTNNPNANLMLASASFDSTVRLWDVDRGICIHTLTKHQEPVYSVAFSPDGR 455

  Fly   672 WFVSTGKDNLLNAWRTPYGASIFQSKETSSVLS-CDISTDDK 712
            :..|...|..::.|.|..||.:...:.|..:.. |..:..||
Human   456 YLASGSFDKCVHIWNTQTGALVHSYRGTGGIFEVCWNAAGDK 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
groNP_996298.1 TLE_N 11..124 CDD:397828
WD40 442..727 CDD:238121 77/344 (22%)
WD40 repeat 447..486 CDD:293791 14/68 (21%)
WD40 repeat 494..532 CDD:293791 8/38 (21%)
WD40 repeat 537..573 CDD:293791 10/36 (28%)
WD40 repeat 580..615 CDD:293791 9/37 (24%)
WD40 repeat 620..653 CDD:293791 9/46 (20%)
WD40 repeat 661..695 CDD:293791 10/33 (30%)
WD40 repeat 702..726 CDD:293791 3/12 (25%)
TBL1XR1NP_001308122.1 LisH 7..31 CDD:369916
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 120..139
WD40 164..470 CDD:238121 70/327 (21%)
WD 1 167..206 9/48 (19%)
WD40 repeat 172..215 CDD:293791 8/52 (15%)
WD 2 223..262 8/39 (21%)
WD40 repeat 228..264 CDD:293791 5/35 (14%)
WD 3 264..303 9/40 (23%)
WD40 repeat 270..306 CDD:293791 8/37 (22%)
WD 4 306..344 12/40 (30%)
WD40 repeat 311..346 CDD:293791 10/34 (29%)
WD 5 347..386 10/38 (26%)
WD40 repeat 353..388 CDD:293791 7/34 (21%)
WD 6 389..437 10/53 (19%)
WD40 repeat 394..439 CDD:293791 9/48 (19%)
WD 7 440..479 11/38 (29%)
WD40 repeat 445..483 CDD:293791 10/37 (27%)
WD 8 481..513 4/17 (24%)
WD40 repeat 486..509 CDD:293791 3/12 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.