DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gro and SPAG16

DIOPT Version :9

Sequence 1:NP_996298.1 Gene:gro / 43162 FlyBaseID:FBgn0001139 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_078808.3 Gene:SPAG16 / 79582 HGNCID:23225 Length:631 Species:Homo sapiens


Alignment Length:722 Identity:126/722 - (17%)
Similarity:211/722 - (29%) Gaps:336/722 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 DTLERIKEEFNFLQAQYHSIKLECEKLSNEKTEMQRHYVMYYEMSYGLNVEMHKQTEIAKRLNTL 90
            :.|.:|::|.:|.:..:..|..|..||.|:...::.||.. ||.:..:..|.|         :||
Human   183 EDLLKIQKERDFHRMHHKRIVQEKNKLINDLKGLKLHYAS-YEPTIRVLHEKH---------HTL 237

  Fly    91 INQLLPFLQADHQQQVLQAVERAKQVTMQELNLIIGHQQQHGIQQLLQQI---HAQQVPGGPPQP 152
            :           ::::|.::||.|         ::|  |..|:|:.|:::   |:.         
Human   238 L-----------KEKMLTSLERDK---------VVG--QISGLQETLKKLQRGHSY--------- 271

  Fly   153 MGALNPFGALGATMGLPHGPQGLLNKPPEHHRPDIKPTGLEGPAAAEERLRNSVSPADREKYRTR 217
                             ||||..:    :|.|.  |....|||  .::.||.:     ||:.:.:
Human   272 -----------------HGPQIKV----DHSRE--KENAPEGP--TQKGLREA-----REQNKCK 306

  Fly   218 SPLDIENDSKRRKDEKLQEDEGEKSDQDLVVDVANEMESHSPRPNGEHVSMEVRDRESLNGERLE 282
            :.:                 :|...|.:..:|:       .|.||     :.| .:|||:..:.:
Human   307 TKM-----------------KGNTKDSEFPIDM-------QPNPN-----LNV-SKESLSPAKFD 341

  Fly   283 KPSSSGIKQERPPSRSGSSSSRSTPSLKTKDM----EKPGTPGAKARTPTPNAAAPAPGVNPKQM 343
                                      .|.|::    |.|                    |:...|
Human   342 --------------------------YKLKNIFRLHELP--------------------VSCVSM 360

  Fly   344 MPQGPPPAGYPGAPYQRPADPYQRPPSDPAYGRPPPMPYDPHAHVRTNGIPHPSALTGGKPAYSF 408
            .                                                 ||...|..       
Human   361 Q-------------------------------------------------PHKDILVS------- 369

  Fly   409 HMNGEGSLQPVPFPPDALVGVGIPRHARQINTLSHGEVVCAVTISNPTKYVYTGGKGCVKVWDIS 473
              .||..|..|         :|:|:              |.|.:   |.:.:|.       | :|
Human   370 --CGEDRLWKV---------LGLPK--------------CNVLL---TGFGHTD-------W-LS 398

  Fly   474 QPGNKNPVSQLDCLQRDNYIRSVKLLPDGRTLIVGGEASNLSIWDLASPTPRIKAELTSAAPACY 538
                       ||.          ..|.|..|......:.:.:|||.      |.:       | 
Human   399 -----------DCC----------FHPSGDKLATSSGDTTVKLWDLC------KGD-------C- 428

  Fly   539 ALAISPDSKVCFSCC--SDGNIA----------VWDLHNEILVRQFQGHTDGASCIDISPDGSRL 591
            .|.....|:..:||.  |.||..          :||:::|.......||||..:.|:..|..:.|
Human   429 ILTFEGHSRAVWSCTWHSCGNFVASSSLDKTSKIWDVNSERCRCTLYGHTDSVNSIEFFPFSNTL 493

  Fly   592 WTGGLDNTVRSWDLREGRQLQ-----QHDFSSQIF------------------------------ 621
            .|...|.|:..||.|.|...|     .|..:..||                              
Human   494 LTSSADKTLSIWDARTGICEQSLYGHMHSINDAIFDPRGHMIASCDACGVTKLWDFRKLLPIVSI 558

  Fly   622 SLGYCP--------TGDWLAVGMENSHVEVLHASKPDKYQLHLHESCVLSLRFAACGKWFVSTGK 678
            .:|..|        :|..||....|..:.:|.....:.::|..||:...::.|:..|:...|.|.
Human   559 DIGPSPGNEVNFDSSGRVLAQASGNGVIHLLDLKSGEIHKLMGHENEAHTVVFSHDGEILFSGGS 623

  Fly   679 DNLLNAW 685
            |..:..|
Human   624 DGTVRTW 630

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
groNP_996298.1 TLE_N 11..124 CDD:397828 21/97 (22%)
WD40 442..727 CDD:238121 60/299 (20%)
WD40 repeat 447..486 CDD:293791 6/38 (16%)
WD40 repeat 494..532 CDD:293791 7/37 (19%)
WD40 repeat 537..573 CDD:293791 11/47 (23%)
WD40 repeat 580..615 CDD:293791 11/39 (28%)
WD40 repeat 620..653 CDD:293791 9/70 (13%)
WD40 repeat 661..695 CDD:293791 6/25 (24%)
WD40 repeat 702..726 CDD:293791
SPAG16NP_078808.3 Prefoldin 160..271 CDD:298833 27/119 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 266..332 22/134 (16%)
WD40 <341..631 CDD:225201 75/463 (16%)
WD40 344..631 CDD:238121 74/434 (17%)
WD 1 350..389 15/142 (11%)
WD40 repeat 355..392 CDD:293791 14/120 (12%)
WD 2 392..431 13/81 (16%)
WD40 repeat 398..434 CDD:293791 12/70 (17%)
WD 3 434..473 9/38 (24%)
WD40 repeat 439..475 CDD:293791 8/35 (23%)
WD 4 476..515 14/38 (37%)
WD40 repeat 482..516 CDD:293791 11/33 (33%)
WD 5 518..557 3/38 (8%)
WD40 repeat 523..559 CDD:293791 2/35 (6%)
WD 6 560..600 7/39 (18%)
WD40 repeat 565..600 CDD:293791 5/34 (15%)
WD 7 601..630 7/28 (25%)
WD40 repeat 607..630 CDD:293791 5/22 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.